(data stored in ACNUC7421 zone)

EMBL: CP000690.PE34

CP000690.PE34        Location/Qualifiers
FT   CDS_pept        43830..44450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3326"
FT                   /product="Holliday junction DNA helicase subunit RuvA"
FT                   /note="PFAM: DNA recombination protein RuvA, domain I;
FT                   SMART: Helix-hairpin-helix DNA-binding, class 1"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3326"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28938"
FT                   /db_xref="GOA:A5FTK6"
FT                   /db_xref="InterPro:IPR000085"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013849"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTK6"
FT                   /protein_id="ABQ28938.1"
FT                   /translation="MITQLTGIPRRIGDQECVIDVHGVGYGVHVPSATLDMIEGEAGPV
FT                   TILIQTRMSDSEISLYGFATPADLQTFRKLVGVQGVGPATALNLLSQLAPEELWRAIRE
FT                   ADQKALTAVKGIGPAAAKRLISELESHAAKLAAEMPAPAARLDLGLSADQLAQSLQRLG
FT                   HAPSAARAAAQFALNGAKPGDTEQELVARALQAAAGMTTGAAA"
     atgatcaccc agcttacggg aattccccgg cggatcggcg accaggagtg cgtcattgac        60
     gtgcatggcg tcggttatgg cgtgcacgtg ccgtccgcga cgctcgacat gatcgagggc       120
     gaggcgggcc cggtcaccat cctgatccag acccggatga gcgacagcga gatctcgctc       180
     tacggctttg cgaccccggc ggacctgcag accttccgca agctggtcgg cgtccagggc       240
     gtcggaccgg cgacggcgct gaacctgctc tcacagctcg ctcccgagga gctctggcgg       300
     gccatccgcg aggcagacca gaaggcgttg accgcggtga aggggatcgg cccggccgcg       360
     gcgaagcggc tgatctccga gctggagagc cacgcagcga agttggcggc cgagatgccc       420
     gccccggccg cccgcctcga tctcggcctc agtgccgatc agctcgccca gtccctgcag       480
     cgtctcggcc acgccccctc ggcagcccgc gccgccgcgc agttcgcact caacggcgcg       540
     aagcccggtg acaccgagca ggaactcgtc gcccgcgcac tccaggccgc agccggcatg       600
     accacgggag cggcggcatg a                                                 621
//

If you have problems or comments...

PBIL Back to PBIL home page