(data stored in ACNUC7421 zone)

EMBL: CP000690.PE35

CP000690.PE35        Location/Qualifiers
FT   CDS_pept        44507..45445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3327"
FT                   /product="Holliday junction DNA helicase subunit RuvB"
FT                   /note="TIGRFAM: Holliday junction DNA helicase RuvB; PFAM:
FT                   AAA ATPase, central domain protein; Holliday junction DNA
FT                   helicase RuvB, C-terminal domain; Holliday junction DNA
FT                   helicase RuvB, N-terminal domain; ATPase associated with
FT                   various cellular activities, AAA_5; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3327"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28939"
FT                   /db_xref="GOA:A5FTK7"
FT                   /db_xref="InterPro:IPR000641"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004605"
FT                   /db_xref="InterPro:IPR008823"
FT                   /db_xref="InterPro:IPR008824"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041445"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTK7"
FT                   /protein_id="ABQ28939.1"
FT                   /translation="MSPALRPQGLADFVGQADTMRNLATFIRAALIRGVSLDHVLLNGP
FT                   PGLGKTTIAQIIAHEMNCNLKTIIGPAVQRAADLAAVLTTMQPNEVLFIDEIHRVQPAA
FT                   AEILYGAMEDFTLDILIGEGPQARSVRIDLPRFTLIGATTRSGSLPAPLRDRFGIHLGL
FT                   EFYSPEDLVRIVTRSAGMLGIGMMPEGAMEIARRSRGTPRIANRLLRRVHDFAVVAGVV
FT                   AITDTIADMALSSLAVDRRGLDKLDRRYIDWIDTVHGGGPVGIDTLATGLGEARETIED
FT                   VIEPFLVASGIITRTSRGRVLTPKAYEVEAR"
     atgtcgccgg cgctccgccc gcaggggctc gccgatttcg tgggccaggc ggacacgatg        60
     cggaacctgg ccacattcat ccgggcggcg ctgatccgcg gtgtcagcct cgatcacgtg       120
     ctgctgaacg gcccgcccgg cctcggcaag acgacgatcg cccagatcat cgcccacgag       180
     atgaactgca acctgaagac gatcatcggg cccgccgttc agcgggcggc cgatctcgcc       240
     gcggtgctga cgacgatgca gccgaacgag gtgctgttca tcgacgagat tcaccgggtg       300
     cagccggccg ccgccgagat cctatacggc gcgatggagg atttcacgct ggacatcctg       360
     atcggggagg ggccccaggc ccgcagcgtg cggatcgacc tgccgcgctt caccctgatc       420
     ggggcgacca cccggtcggg atcgctgccg gcgccgctgc gcgaccggtt cggcattcat       480
     cttgggctgg aattctactc gcccgaggac ctcgtgcgga tcgtcacccg ctcggccggc       540
     atgctcggta tcgggatgat gccggagggg gccatggaga tcgcccgccg gtcgcgcggc       600
     acgccgcgta ttgccaaccg gctgctccgc cgggtgcacg atttcgccgt ggtggcgggc       660
     gtcgtggcga tcacggacac gatcgccgac atggcgctct cgagcctggc ggtcgaccgg       720
     cgcggcctcg acaagctgga tcggcgctac atcgactgga tcgacaccgt ccatggcggc       780
     gggccggtcg ggatcgacac cctggctacc ggactggggg aggcccgcga gaccatcgag       840
     gacgtgatcg agccgttcct ggtggcatcc gggatcatca cgcggaccag ccgcggccgg       900
     gttctcaccc ccaaggctta cgaggtggag gcacggtga                              939
//

If you have problems or comments...

PBIL Back to PBIL home page