(data stored in ACNUC7421 zone)

EMBL: CP000690.PE36

CP000690.PE36        Location/Qualifiers
FT   CDS_pept        45445..45996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3328"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3328"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28940"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTK8"
FT                   /protein_id="ABQ28940.1"
FT                   /translation="MQHRRDQRLMGTVDQLAPLFTTTVQNDIFLIGIDMGDPAHPAGAA
FT                   ILFSGDDEFYGQISDAMPASALSDLAVVFHAADKRIATMMRSSGRRALPREMPDGIASQ
FT                   DLKASPGLVAHRPPFAIIRGANEASGTVLVHLLIQAAGTAEWRTALRVSSGWLGRLAGL
FT                   AEEASRYPGQALVAQHHSPF"
     atgcagcacc gtcgcgacca acggctgatg gggacggttg atcagctcgc gccgctgttc        60
     acgacgaccg tgcagaacga catctttctg atcggcatcg acatgggcga tccagcgcac       120
     ccggccggcg cggcaatcct gttttccggc gatgatgaat tctacgggca gatctcagac       180
     gcgatgccgg cgtcagccct cagcgacctc gcagtggttt tccatgccgc cgacaagcgc       240
     atcgcgacga tgatgcgcag ctcggggcgc cgtgccttgc cgcgcgagat gcccgatggg       300
     attgccagcc aggatctcaa ggctagcccc ggcctggttg cccaccgccc gccctttgcg       360
     attatccggg gcgcaaacga ggcttcgggt acggtgctcg tgcacctgct gatccaggca       420
     gccgggacgg ccgagtggcg gaccgcgctc agggtgtcgt cggggtggct tggccgtctg       480
     gcgggattgg ctgaagaggc gagccggtac cccggtcagg cgttggtcgc ccagcatcac       540
     tcgcccttct ga                                                           552
//

If you have problems or comments...

PBIL Back to PBIL home page