(data stored in ACNUC7421 zone)

EMBL: CP000690.PE37

CP000690.PE37        Location/Qualifiers
FT   CDS_pept        complement(46324..46656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3329"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3329"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28941"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTK9"
FT                   /protein_id="ABQ28941.1"
FT                   /translation="MSRSTSPTAAPALRGVGPNLILNGNGFYVSYNDFDRGIYGGDTTA
FT                   LVLGQMERFFILNGDHRGQYAPPDRARLRCLSRLFPGQHGAHELPQRPAALPRHGWGGD
FT                   ADPVKG"
     atgagccgtt cgaccagtcc gaccgcggca cccgcactcc gcggcgtggg ccccaacctg        60
     atcctgaatg gcaacggctt ctacgtgtcg tacaacgact tcgaccgcgg catttatggc       120
     ggcgacacaa cggccctggt tctcggccag atggagcgct tcttcattct gaacggcgac       180
     caccgtggcc agtatgcccc ccctgatcga gcgcggcttc gatgcctgtc tcgcctattt       240
     ccgggacaac atggagctca tgaacttccg cagcgacctg ccgccctgcc ccgacacggc       300
     tggggaggcg acgccgaccc cgtgaagggc tga                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page