(data stored in ACNUC7421 zone)

EMBL: CP000690.PE38

CP000690.PE38        Location/Qualifiers
FT   CDS_pept        46722..46973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3330"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28942"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTL0"
FT                   /protein_id="ABQ28942.1"
FT                   /translation="MCHRFEIDAEYRRRRARLLAEKGTGFRSLGVGGADATTPHGRLML
FT                   TVLGGMVEFDREWILVLDVRMGPKPKLPLYQRHKALRR"
     ttgtgccatc gcttcgaaat cgatgctgaa tatcggcgcc ggcgcgctcg gctcctcgcc        60
     gagaagggca ccgggttcag atccctcggg gtcggcgggg ccgacgccac caccccgcac       120
     ggccggctga tgctgaccgt ccttggcggc atggttgagt tcgaccggga gtggatcctg       180
     gtcctcgacg tacgtatggg ccccaagccg aaactgcccc tttaccagcg gcataaagcc       240
     ctacgtcggt ga                                                           252
//

If you have problems or comments...

PBIL Back to PBIL home page