(data stored in ACNUC7421 zone)

EMBL: CP000690.PE39

CP000690.PE39        Location/Qualifiers
FT   CDS_pept        47613..48353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3331"
FT                   /product="YceI family protein"
FT                   /note="PFAM: YceI family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3331"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28943"
FT                   /db_xref="InterPro:IPR007372"
FT                   /db_xref="InterPro:IPR036761"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTL1"
FT                   /protein_id="ABQ28943.1"
FT                   /translation="MLSNYFDPPPMPTECSVTDGFACASRHASLQAPYPAHLRGVFVDG
FT                   SPRRMHRAPSLTAVTLLALSAFTPARAAELYHLNQRNSTIRFSVGTLGFFRARGHFAQF
FT                   DATLLIDPAHPTSTRVSVTIPTASVVTPWAQESAMIRSPDFFDVARYGKIRFTSGNVTA
FT                   TAPGHYAVHGQLTLRDVTRPVILAAHLVKTATDPTAGDTIDDFTITGTVRRKAFGIVAD
FT                   PVFIDNRVHIVIHARILVLASGHG"
     atgctatcta attatttcga tcccccccca atgccgacag agtgtagcgt gacggacgga        60
     tttgcctgcg cgtcccgcca cgcatcttta caggcgccgt atccggctca tttaagaggt       120
     gtatttgttg acggaagccc acgccgaatg catcgcgcgc cttcactcac tgccgtcacc       180
     ctgctcgctc tcagcgcctt cacaccggcc cgagccgccg aactctatca cctcaaccag       240
     aggaacagca ccatccgctt cagcgtaggc acgctcggct tcttccgcgc ccgtggccat       300
     ttcgcgcagt tcgatgccac cttgctgatc gatcccgcac acccgaccag cacgagggtg       360
     agcgtcacca tccccacggc ctctgtcgtg acaccttggg cgcaggaaag tgcgatgatc       420
     cggtctccgg atttcttcga tgtcgcgcgc tacggcaaga tccggtttac cagcggaaac       480
     gtcacggcca cggcaccggg ccactacgcg gtccatgggc agctcacgct gcgggacgtg       540
     acgcgacccg tgatcctcgc ggctcacctc gtcaaaaccg caacggaccc cacggccggt       600
     gatacgatcg atgatttcac aattaccggc accgtccgcc gcaaggcgtt cggcatcgtc       660
     gccgacccgg ttttcatcga taacagggtc cacatcgtca tccacgcccg catcctcgtc       720
     ctggcgtccg ggcatggctg a                                                 741
//

If you have problems or comments...

PBIL Back to PBIL home page