(data stored in ACNUC7421 zone)

EMBL: CP000690.PE4

CP000690.PE4         Location/Qualifiers
FT   CDS_pept        7943..8677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3296"
FT                   /product="protein of unknown function DUF159"
FT                   /note="PFAM: protein of unknown function DUF159"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3296"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28908"
FT                   /db_xref="GOA:A5FTH6"
FT                   /db_xref="InterPro:IPR003738"
FT                   /db_xref="InterPro:IPR036590"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTH6"
FT                   /protein_id="ABQ28908.1"
FT                   /translation="MCNLSSVTKGQQAIRELTRAMLDTTGNLPSLPAIFPDALAPVVRN
FT                   APDGERELTMMRWGMPGPSQLGGAPVTNIRNTTSPHWRRWLPPQNRCLVPATSFSEWAD
FT                   TKPKKTPVWFALDQSRPLFAFAGLWTVWHGKRGTKANPIEGELRLFGFLTTEPNSIVRP
FT                   IHPKAMPVILTTPEEMDVWMRASWSEAAGLQRPLPGTKLVIMNYRRQAAHAALAKVSVT
FT                   MDRARSSPKIRWPMFHSTQADA"
     atgtgtaacc tctccagtgt cacgaaaggg cagcaggcaa tccgcgaatt gacccgggcc        60
     atgctcgata cgacaggcaa tctgccgtcc cttcctgcta tcttccccga tgcgctggcc       120
     ccagtggttc gcaatgcacc cgacggcgag cgcgagctga cgatgatgcg gtggggcatg       180
     ccaggtccat cgcaattggg cggcgcgccg gtgaccaata tccgcaatac caccagcccg       240
     cattggcggc gctggctccc accgcagaac cggtgcctcg tgcctgccac gtcgttcagc       300
     gaatgggcgg acaccaagcc gaagaaaacc ccggtctggt tcgctctcga ccagagccgg       360
     ccgctcttcg cgtttgccgg tctctggacg gtttggcacg gcaaacgagg cacgaaggca       420
     aacccgattg agggtgagct tcggctcttc gggtttctca cgactgaacc aaacagtatc       480
     gtccgtccga tccacccgaa agccatgccc gtcatcctga cgactcctga ggaaatggac       540
     gtctggatgc gggcgtcgtg gtccgaggcg gcgggactgc aacggcccct gcctggtacc       600
     aaactcgtca ttatgaacta ccgccgccaa gccgctcacg cggctctggc gaaggtttcg       660
     gtcacaatgg accgggcccg ttcctcaccc aagatacgct ggccgatgtt ccacagcacc       720
     caagctgacg cctga                                                        735
//

If you have problems or comments...

PBIL Back to PBIL home page