(data stored in ACNUC7421 zone)

EMBL: CP000690.PE41

CP000690.PE41        Location/Qualifiers
FT   CDS_pept        49942..50958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3333"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3333"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28945"
FT                   /db_xref="InterPro:IPR024442"
FT                   /db_xref="InterPro:IPR024445"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTL3"
FT                   /protein_id="ABQ28945.1"
FT                   /translation="MDVLAREDLPFPQSLPEFQRIFPNDAACAAYLESARWNGGFACPR
FT                   CGVVGEPFRFEARPGVLRCRACRKDVSLMAGTVMERSHTPLSTWFWAAYLIASQTPGMS
FT                   AVQFQRQLGLSRYETAFGILHKLRAGMVRPERDKIGDTPQEHVEVDETWVGGRTRGDGR
FT                   GVHHKVLVACAVEVRHRKPGTKLDNRKDGRYAGRVRLAVVPDRSANSLCGFVENAVAPG
FT                   SLIVTDDWSGYAGLGRRGFDHHAIAECGDPEVAEEFLPIVHLVFTNLKTWINGIHHGVS
FT                   AKHLQAYLNEFTFRFNRRLYPFNAFRSLLGIAGRAAAPTFDELYSGEWTHPTFSGCG"
     atggatgtcc tggcccgtga agacctgccg ttcccgcagt ctctgccgga attccagcgt        60
     attttcccga acgacgcggc ctgtgccgcc tatctcgaaa gcgcccgctg gaatggaggg       120
     ttcgcctgcc caaggtgcgg cgtcgttggc gagccgttcc gtttcgaggc gcgcccgggc       180
     gttctgcgct gccgggcctg tcgcaaagac gtaagcctga tggctgggac cgttatggaa       240
     cgcagtcaca cgccgctgtc gacttggttc tgggcggctt acttgatcgc cagccagacg       300
     cccggaatgt cggccgtcca atttcagcgg caactcggcc tgtcgcgcta cgagaccgcc       360
     ttcggcatcc ttcataagct gcgcgccggg atggtgcgcc ccgagcgcga caagattggc       420
     gacacgccgc aagaacacgt cgaagtggat gaaacgtggg ttggaggacg aacccgaggc       480
     gatggacggg gtgtccatca caaggttctc gtcgcctgtg ccgtggaggt gcgccaccgg       540
     aaaccgggaa ccaagctcga caatcggaaa gacggtcgct acgcgggacg cgttcgtctc       600
     gctgttgtcc ccgaccgtag cgccaattcg ctctgcggat tcgtcgaaaa cgccgttgct       660
     cccggatcgc tgatcgttac cgacgactgg agcggctatg ccggtctcgg aaggcgcggg       720
     ttcgaccacc atgcaatcgc cgaatgcggc gacccggagg tggcagaaga attcctgccg       780
     atcgtccact tggtctttac caacctgaag acctggatca acggcatcca tcacggggtc       840
     agcgccaaac atctacaagc ctacctcaat gaattcacgt ttcggttcaa ccggcgcctc       900
     tatcccttca acgcgttccg ctcgctgctc ggaatcgcgg gtagggcagc cgcaccaacc       960
     tttgacgagc tttattccgg ggaatggaca caccctacat ttagtgggtg tgggtaa         1017
//

If you have problems or comments...

PBIL Back to PBIL home page