(data stored in ACNUC7421 zone)

EMBL: CP000690.PE42

CP000690.PE42        Location/Qualifiers
FT   CDS_pept        complement(51404..52369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3334"
FT                   /product="diguanylate cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3334"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28946"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTL4"
FT                   /protein_id="ABQ28946.1"
FT                   /translation="MDITKVLENVDKNQIHKIINYLPIPIFIIASNYRFVSVNKPMCNF
FT                   FDCTIEAFLRKTDDFIIPKKNIDASRKITDEIFSSGQPYEDEEILTDGRGEQHIFLIYK
FT                   RLIHLQQAGYETPFVITVLMDVTRFREAEKNATHRALHDTLTGLANRSHLNQRLKEAVT
FT                   VSTANAQGFAILLLDLDGFKSINDRFGHQAGDQILCVVAKRLTDTIRRNDVVARLGGDE
FT                   FCIVQANVDHPDQAHELADRVVHAVSRPIPFGSIELTISASVGIALFPEDGDGPDALLR
FT                   KADLGLYQVKGNGRAGYLRHALDARSLQSDGRNHATNEWN"
     atggatatta caaaagtatt ggaaaatgtt gataaaaatc aaattcataa aataataaat        60
     tatttaccaa ttccaatttt cataatagct tcaaattatc gattcgtttc tgtaaataaa       120
     cctatgtgta acttttttga ttgtacaatc gaagcgtttc tcagaaaaac tgatgatttt       180
     ataattccca agaagaatat cgacgcctcc cgtaagatta cggatgaaat attttcgagc       240
     ggccagccgt atgaagacga ggagatttta accgatggca ggggtgagca acatattttt       300
     ttgatctaca agcgattgat tcacctacaa caggctgggt acgaaactcc atttgtcatc       360
     actgtcttga tggatgtaac ccggtttcgt gaagccgaaa aaaatgccac gcaccgcgcc       420
     ctccatgaca cgctgaccgg cctggccaac cgaagccatc ttaaccagcg ccttaaggag       480
     gctgtcaccg tttccactgc caatgcgcag gggtttgcga tcttgcttct ggacctcgat       540
     ggcttcaaat cgatcaacga taggtttggt catcaggccg gcgaccaaat cttgtgtgtc       600
     gttgccaaaa ggctgacgga caccattcgt agaaacgacg ttgtggctcg gcttggcggc       660
     gacgaatttt gtatcgtcca agccaacgtc gaccatcctg accaggcaca cgaattggcc       720
     gaccgtgttg tacatgcggt cagcagaccc atcccgttcg gctccatcga acttactatc       780
     tctgcatctg tcgggatcgc tcttttcccg gaagacggtg atggaccaga cgcactgtta       840
     cggaaggctg acctagggct ttatcaagtg aaggggaatg gtcgagcagg ctatcttcgg       900
     cacgctttag acgcacgctc attgcagtcc gacggcagga accacgcgac aaatgagtgg       960
     aattga                                                                  966
//

If you have problems or comments...

PBIL Back to PBIL home page