(data stored in ACNUC7421 zone)

EMBL: CP000690.PE43

CP000690.PE43        Location/Qualifiers
FT   CDS_pept        53072..53572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3335"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3335"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28947"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTL5"
FT                   /protein_id="ABQ28947.1"
FT                   /translation="MSGIMPPPLPSPSQSFASALRAFLDTLIAVAAWRGEDFRQVWVVE
FT                   SAKAIRSAMEQGPIWATMEDLIPDDDDLLSKVAFDVLETEMLYVAFRYRRLLPEESRKV
FT                   VASVEERFAGVQEGDPTAPGAVDDIETVKGSIERQIKKLPKWLQRVLEVLMELLKLTKG
FT                   MIH"
     atgtcgggca ttatgccgcc tccattacct tctccctcac agagctttgc ctcggctctt        60
     cgggcattcc ttgacacact gatcgccgtg gcggcttggc gcggtgaaga tttccgtcag       120
     gtgtgggttg ttgaatcggc caaggcaatt cggtcagcca tggagcaggg gccaatatgg       180
     gcgacgatgg aagaccttat tcctgacgat gatgaccttc tgagcaaggt ggcatttgat       240
     gtgcttgaaa cagaaatgct ttatgtggcc ttccgttatc gccgcctgtt gcctgaagag       300
     agccgcaagg tcgtcgcgag cgtggaagag cgatttgcag gtgtccagga gggtgatccg       360
     accgcgcccg gcgctgttga tgacatcgag acggtgaaag gaagcattga gagacaaatc       420
     aagaaacttc caaagtggct gcagcgcgtt cttgaagttc tgatggagct tctcaagctg       480
     acaaagggta tgattcactg a                                                 501
//

If you have problems or comments...

PBIL Back to PBIL home page