(data stored in ACNUC7421 zone)

EMBL: CP000690.PE44

CP000690.PE44        Location/Qualifiers
FT   CDS_pept        53885..54379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3336"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3336"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28948"
FT                   /db_xref="GOA:A5FTL6"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTL6"
FT                   /protein_id="ABQ28948.1"
FT                   /translation="MVSRAAAAACFGIALAMAMARYASLYRAMQIVGGLYLIWLGVGAS
FT                   RAKPGSAETGAVSARPAGLTRGILTGAVLNLGNLKIVVFFTSIFVALLPASAPLWVRLA
FT                   ATAIVGAQEAAWYILVAMLFSRPRAQVAYRRAGVWIERVVGMVLFGIGADIVVASVKSG
FT                   V"
     atggtgagcc gggcggcggc ggcggcgtgt ttcggcattg cgctggcgat ggcgatggca        60
     cggtatgcat cgctttaccg ggcgatgcag atcgtcggcg ggctgtattt gatctggctc       120
     ggggtcggag cgtcgcgggc caagccgggt tcggccgaga cgggcgcagt ttcagcgcgg       180
     ccggcggggc tgacgcgcgg gattttgacc ggagcggtgc tcaatctggg caatctgaag       240
     atcgtggtct tcttcaccag tattttcgtg gcgctgctgc cggcctcggc gccgctctgg       300
     gtgcggctgg cggcgacggc gatcgtcggc gcgcaggagg cggcctggta tattctggtg       360
     gccatgttgt tttcgcggcc tcgggcgcag gtggcttatc ggcgggcggg cgtttggatc       420
     gagcgggtgg tagggatggt tttgttcggg atcggggcgg atatcgtcgt cgcgagtgtg       480
     aaatcgggcg tgtga                                                        495
//

If you have problems or comments...

PBIL Back to PBIL home page