(data stored in ACNUC7421 zone)

EMBL: CP000690.PE45

CP000690.PE45        Location/Qualifiers
FT   CDS_pept        complement(54386..55231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3337"
FT                   /product="protein of unknown function DUF6, transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6,
FT                   transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3337"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28949"
FT                   /db_xref="GOA:A5FTL7"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTL7"
FT                   /protein_id="ABQ28949.1"
FT                   /translation="MTIPPWAITAVLAGAALHAAWNVAIRGGADRRSATIGLILGGAVI
FT                   AGATLPFLPRPRAAAWPHLLATALLHIVYFNLVAEAYARGAVSLIYPVMRGTAPALTAL
FT                   IATIFLGETLGGAGWCGLLLISAGVGLLARRRGEAGEGRALMLALANAIIIALYTANDG
FT                   VGVRLSEAPLAYALWTFVLPAIPAILILARFSPTRLRAALKPGPLLRGFGGGACSIASY
FT                   ALALWAMTQAPIGAIAALRETALLFGVLFAWWFLHERPGSRGLTAIAIIAAGATVLRLG
FT                   "
     atgacgatcc cgccctgggc gataacggcg gtcctggcgg gcgccgcgct gcacgccgcc        60
     tggaatgtcg ccattcgcgg cggcgccgac cgccgcagcg cgacaatcgg tctcatcctg       120
     ggcggcgccg tcattgccgg tgccacgctg cccttcctgc cacggccccg cgccgccgcc       180
     tggccgcatc tgctggcgac ggcactgctg cacatcgtct atttcaacct cgtcgccgaa       240
     gcctatgcgc gcggcgccgt cagcctcatc tatccggtaa tgcgcggcac cgccccggcg       300
     ctgaccgcgc tgatcgccac aatcttcctc ggcgaaaccc tcggcggcgc cggctggtgc       360
     ggcctgctgc tcatctcggc aggcgtcggc ctgctcgccc gccggcgcgg cgaggcgggg       420
     gaaggccgcg ccctgatgct cgccctggcg aatgccatta tcatcgccct ctacaccgcc       480
     aatgatggcg tcggcgtccg cctttccgaa gcccccctcg cctatgcgct atggaccttc       540
     gtgcttcccg ccatcccggc gatcctcatc ctcgcccgct tcagccccac ccgcctgcgc       600
     gcggccctga aaccgggccc gcttctgcgc ggcttcggcg gcggcgcctg ctccatcgcc       660
     tcctacgccc tggccctctg ggcaatgacc caggccccga tcggcgccat cgccgccctg       720
     cgcgaaaccg ccctgctgtt cggcgtgctc ttcgcctggt ggttcctgca tgaacgcccg       780
     ggaagccgcg gcctcaccgc catcgccatc atcgcggcgg gtgccaccgt gctccgcctg       840
     gggtga                                                                  846
//

If you have problems or comments...

PBIL Back to PBIL home page