(data stored in ACNUC7421 zone)

EMBL: CP000690.PE46

CP000690.PE46        Location/Qualifiers
FT   CDS_pept        complement(55335..55895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3338"
FT                   /product="Resolvase, N-terminal domain"
FT                   /note="PFAM: Resolvase, N-terminal domain; Resolvase
FT                   helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3338"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28950"
FT                   /db_xref="GOA:A5FTL8"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTL8"
FT                   /protein_id="ABQ28950.1"
FT                   /translation="MISIQTPAHSVALTGAFMSASLHHRQAAFGGWLQKVSGAKRGRQE
FT                   LARLLDHLRAGDVVTVTRLDRLARSTRDLLDIAERIKEAGASLRSLAEPWADTTTPAGR
FT                   MVLTVFAGMADFERSLIVERTSTGRIAAKARGVRFGPQPALATDQIAHARQLIEADGKS
FT                   VAEVARLLGVHRATLYRALEKRQ"
     atgatctcca tccaaactcc cgctcatagc gtcgccctta caggcgcatt tatgagcgca        60
     tcactccatc atcgacaggc ggcattcggc ggatggttac agaaggtcag cggggcaaag       120
     cgtggccggc aagaattggc acgcctgctc gatcacctgc gtgccggtga cgtggtgacg       180
     gtcacgcgcc tggaccggct tgcccgctcc acgcgcgatc tgctggatat tgccgagcgt       240
     atcaaagagg ctggcgccag cttgcgctca ctggccgagc cgtgggccga taccacgacg       300
     ccggccggcc gcatggtgct caccgtgttc gccggcatgg ccgatttcga gcggtccctt       360
     attgtcgaac gcaccagcac cggcaggatc gcagccaagg cgcgcggtgt gcgttttggg       420
     ccgcagcctg ctctcgcgac cgaccagatc gctcatgccc gtcagctcat cgaggcggac       480
     ggcaaatccg tggccgaggt tgcccgcttg ctgggcgtcc accgggccac cctctaccgg       540
     gccttggaga aacgccaata g                                                 561
//

If you have problems or comments...

PBIL Back to PBIL home page