(data stored in ACNUC7421 zone)

EMBL: CP000690.PE47

CP000690.PE47        Location/Qualifiers
FT   CDS_pept        55948..56460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3339"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="PFAM: transposase IS3/IS911 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3339"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28951"
FT                   /db_xref="GOA:A5FTL9"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTL9"
FT                   /protein_id="ABQ28951.1"
FT                   /translation="MAQAEAPGAVFAEVARRHDISRGQLWNWRRLVRAGELSLASAPAQ
FT                   FLPVRMSPELSAAAMIAGPEDTDRASVAAPRNQGRLEVRLAGGTRVVIEGMVAPAVVTA
FT                   PRIRTGTAVNICSARRMPAPSRLAATGWSTACGKQVFRSEKVRPKLKMRLIRRLNPEMV
FT                   GYSQKVA"
     gtggcgcaag cggaggcgcc tggtgcggtg tttgcggaag ttgcgcggcg gcatgacata        60
     tcacgtggtc agctatggaa ctggcgccgt ctggtgcgtg ctggcgaatt gagtttggct       120
     tcggcacctg cgcaattcct gccggttcgt atgtcgccgg agttgtcggc cgctgcgatg       180
     attgcggggc ctgaggatac ggatcgggcg tctgttgcgg cgccgcgcaa ccagggtcgg       240
     ctcgaggttc gtctggctgg cggtacgcgg gtggtgatcg agggcatggt ggcgccagcg       300
     gtggtcacgg cgccgaggat ccggactggc accgccgtga acatctgttc cgcgcggcgg       360
     atgcccgcgc cgtcgcggct cgctgcaaca ggctggtcga ccgcatgcgg gaagcaggtg       420
     ttccgctccg agaaggtgcg cccgaagctc aagatgcggt tgatccgtcg cctgaaccct       480
     gaaatggtgg gctattcgca aaaggtggcc tga                                    513
//

If you have problems or comments...

PBIL Back to PBIL home page