(data stored in ACNUC7421 zone)

EMBL: CP000690.PE48

CP000690.PE48        Location/Qualifiers
FT   CDS_pept        56496..56885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3340"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3340"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28952"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTM0"
FT                   /protein_id="ABQ28952.1"
FT                   /translation="MGTVRVMFRPRRQSPVVPVRLRRRAFFEGVFDMSALSMLSGHLSV
FT                   STAARVSAGQIAVALETGHLSAIGDSHARALVAGVFSEHDPDLILRATSEAGGTPATAN
FT                   ALYLESLADGMPCCPGWEHLMREIL"
     ttgggcaccg ttcgtgttat gttcaggccg cgcagacaat ctcccgtggt gccggttcgt        60
     ttgcgacggc gcgctttttt tgaaggggta ttcgacatgt cggccctgtc gatgctgtcc       120
     ggacatctga gcgtctcgac ggcggcacgg gtgagtgctg gccagatcgc tgtggctttg       180
     gaaacaggtc atttgtcggc gatcggcgac agccatgccc gcgcactcgt tgccggcgtc       240
     ttcagcgagc acgatccaga cctgatcctt cgcgccacgt ccgaggccgg tggaaccccg       300
     gctacagcca atgccctcta cctggagagc ctggcggacg gcatgccctg ttgtcccgga       360
     tgggagcatc tcatgcgtga aatcctgtga                                        390
//

If you have problems or comments...

PBIL Back to PBIL home page