(data stored in ACNUC7421 zone)

EMBL: CP000690.PE49

CP000690.PE49        Location/Qualifiers
FT   CDS_pept        57023..57577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3341"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3341"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28953"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTM1"
FT                   /protein_id="ABQ28953.1"
FT                   /translation="MLAYEHRISHDIDLFIHDAQWIGFLTPRLHDDAGRFPLYEEASNF
FT                   LKIKLPEGEIDFIVGMSLLGLADESYPGVPFALEPVAEVLAKKLFYRGASLTARDLYDW
FT                   WAVSSATPDVFPAAQVVSLLGSKVSGVETGLKNLSRSKAALGVWDALITSAKPKLTEAI
FT                   AWAENQLMVGPTLNVARTGRP"
     atgctcgcgt atgagcacag gatcagccac gacatcgacc ttttcatcca tgacgcgcag        60
     tggatcggct ttctgacgcc tcggctgcat gatgatgcag gcaggttccc actatacgaa       120
     gaggcatcga atttcctgaa gatcaaactt cctgagggtg agatcgactt cattgtgggg       180
     atgtctttgc tgggccttgc cgatgagtcg tacccagggg taccgttcgc cctggagccg       240
     gtcgccgagg tcctggcgaa gaagctcttc taccgcggcg cctcactcac ggcgcgggat       300
     ctttatgatt ggtgggcggt gtccagcgcc actcctgatg tctttccggc ggcacaggtc       360
     gtgtctctcc ttggctcaaa ggtgagcggc gtcgaaacgg gtctgaaaaa tctatcgcgg       420
     tccaaagccg cgctgggtgt ctgggatgcg ttgatcacca gtgcaaagcc gaaactcaca       480
     gaggctatcg cgtgggcaga aaaccagctc atggtgggcc caaccttgaa tgtcgcccgg       540
     acgggccgac catga                                                        555
//

If you have problems or comments...

PBIL Back to PBIL home page