(data stored in ACNUC7421 zone)

EMBL: CP000690.PE52

CP000690.PE52        Location/Qualifiers
FT   CDS_pept        complement(59338..59736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3344"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3344"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28956"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTM4"
FT                   /protein_id="ABQ28956.1"
FT                   /translation="MPPGPLAYRLDRRELRLITPLSCHVLNRAKPVGQDRIGGDCLGLL
FT                   SETYVEVDPGCLGRLLQPLPLNAYTVGHGEQLIERVRPHVAHDHAAERVADIVNENGYS
FT                   GVPQAPPWKLASERICQITKTVSLIQYK"
     ttgccgccag gccctttggc gtatcgcctc gatcgtcgcg agcttcgcct gatcaccccg        60
     ctgtcgtgcc acgtgctcaa ccgggccaaa ccggtcggtc aggatcgcat cggcggcgat       120
     tgcctgggcc ttctttccga gacttatgtc gaagtggacc caggatgcct tgggcggctg       180
     ctgcagccac ttcctctgaa cgcctatacg gtcggccatg gcgagcagct catcgagcgt       240
     gtccgcccac atgtggcaca tgaccatgcg gccgaacggg tggcggacat cgtcaacgaa       300
     aacggctatt cgggcgttcc tcaagctccg ccatggaagt tggcttcaga gcgcatatgt       360
     cagattacaa aaacagtatc cttgatacaa tacaaatag                              399
//

If you have problems or comments...

PBIL Back to PBIL home page