(data stored in ACNUC7421 zone)

EMBL: CP000690.PE53

CP000690.PE53        Location/Qualifiers
FT   CDS_pept        complement(59936..60745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3345"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="PFAM: regulatory protein, IclR"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3345"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28957"
FT                   /db_xref="GOA:A5FTM5"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTM5"
FT                   /protein_id="ABQ28957.1"
FT                   /translation="MAEDIERDLKPKPGVPLVRALDRGIALLRAFSLTKPRQTLTELTK
FT                   AAELDKGTTRRLLQTLIIAGLVDHDERSGLYALSVGVLEIASAVHTGRELREVAAPYLS
FT                   DIAELCHMTTFLWVHHDGMAVCTERVRSAQPSIDAPWFGVGARTPLNCGAGPRVLLANI
FT                   TPEERESALRKPLVARTPVSQTDPDELRQAAERIRAAGYELAVDDFVPGLAAIGVPVFD
FT                   RSGAFAGSISITSLTSQIVDNGKPRFLAELQKAALEIGRKLIEPHRL"
     atggccgagg acattgagcg cgatttgaag ccgaaacccg gcgtgccgct ggtgcgtgcg        60
     ctcgatcgcg gcatcgcgct attgagagct ttttctctga cgaagccaag gcagaccctt       120
     actgagctca ctaaggcagc cgagctggac aaaggcacga cgcggcgcct gcttcagacg       180
     ttgattattg caggtctggt cgaccatgat gagagaagcg gcctatacgc cctcagcgta       240
     ggcgttttgg agatcgcgtc ggcagtccac accgggaggg agcttcgaga ggtcgcggcg       300
     ccatacctga gcgacatcgc agagctgtgt cacatgacga cgttcttgtg ggtgcaccat       360
     gacggaatgg cggtttgcac ggagcgtgtc cgatctgcac agcccagcat cgatgcccct       420
     tggttcggag ttggtgcacg cacgccgctc aactgtggcg ccggaccgcg tgttctgctc       480
     gccaacataa cccctgaaga gcgcgaaagc gcgctccgca aacccttggt ggcacggacc       540
     cccgtcagtc aaaccgatcc ggatgaactc aggcaggcgg cggaacgcat ccgggctgca       600
     ggctatgaac tcgctgtcga cgacttcgtc cccggcctag ccgccatcgg tgtcccggtg       660
     ttcgatcgct caggcgcctt tgcagggtcg atcagcatca cgagcctgac cagtcagatc       720
     gtcgacaacg ggaaaccgcg cttcttggcg gagctgcaga aggcagcgct tgagattggc       780
     cgcaagctga tcgaacctca tcgcctgtga                                        810
//

If you have problems or comments...

PBIL Back to PBIL home page