(data stored in ACNUC7421 zone)

EMBL: CP000690.PE55

CP000690.PE55        Location/Qualifiers
FT   CDS_pept        61818..63128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3347"
FT                   /product="acetylornithine deacetylase"
FT                   /EC_number="3.5.1.16"
FT                   /note="TIGRFAM: acetylornithine deacetylase or
FT                   succinyl-diaminopimelate desuccinylase; PFAM: peptidase
FT                   M20; peptidase dimerisation domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3347"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28959"
FT                   /db_xref="GOA:A5FTM7"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010182"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTM7"
FT                   /protein_id="ABQ28959.1"
FT                   /translation="MSLDPALREKILASVESGFAEQIAFTEELIRFASVRGAEHACQDF
FT                   VFRALRERGFAMDRFAMDRDAIAAHPGGSPWSEQHSDAPIVVGIHYPQEEKGKSLILQA
FT                   HVDVVPPGPAEMWTNGAFNPVVEGDWLYGRGGADMKAGHAANFFCLDALRRIGLQPAAT
FT                   VYVQSVVEEESTGNGALMTHLRGYKADAVLIPEPEEEMLVRANVGVLWFRVEVRGRPVH
FT                   VREMGNGANAIDAAYRVISELRKLEQEWNDAKTGREHFADVEHPINLNIGKIEGGDWAS
FT                   SVPCWCRIDCRIGLYPGVNAAEASKEISDRVAAFARSDAFMGNNPPSVTFNGFHAEGYV
FT                   QAPGTEAEAVLARAHEGSTGKPLQSFMTPGYLDTRVYALYDKIPALCYGPISENIHGFD
FT                   ERVSIASLKRITGTMALFVAEWCGVEPIKTWPRCHGG"
     atgtccctcg atcctgcatt gcgcgagaag atcctagcct ccgtcgagtc cggtttcgca        60
     gagcagatcg cctttaccga ggagttgatc cgctttgcct cggtgcgcgg cgccgaacat       120
     gcgtgccagg atttcgtctt ccgcgcgctg cgggagcgcg gcttcgccat ggatcgattt       180
     gcgatggatc gtgacgcgat cgccgcccac cctggcggca gcccgtggtc ggaacagcac       240
     tccgatgcgc cgatcgtcgt tggcatccat tatccccagg aggagaaagg taagtcgctg       300
     atcctccagg ctcatgtcga cgtcgtgcca cccgggcccg cggagatgtg gaccaacggg       360
     gccttcaacc cggtcgtcga gggcgactgg ctctatggcc gcggtggcgc cgacatgaag       420
     gcgggccatg ccgccaactt cttctgcctg gacgcgttgc ggcgcattgg ccttcagccg       480
     gctgcgacgg tctacgtcca gtcggtggtt gaggaggagt ccacaggcaa cggcgcgctc       540
     atgacgcacc tgcgcggcta caaggccgat gccgtgctca ttcccgagcc agaggaagag       600
     atgctggtgc gcgccaatgt cggcgtcctt tggttccggg tcgaggtccg cggccggccg       660
     gtgcacgtcc gagagatggg caacggcgcc aacgctatcg acgcggccta tcgcgtcatc       720
     agtgagctgc ggaagctgga gcaggaatgg aacgacgcca agaccggtcg cgagcacttc       780
     gccgacgtcg aacatcccat caacctgaat atcggcaaga tcgaaggcgg cgattgggcg       840
     tcctcggtgc cgtgctggtg ccggatcgat tgccgcatcg gtctctaccc aggcgtgaat       900
     gccgccgaag cgtccaagga gatcagcgac cgcgtggcgg ccttcgctcg ttccgacgca       960
     ttcatgggca acaacccgcc gagcgtcacg ttcaacggct tccacgccga gggctatgtc      1020
     caagcccccg ggaccgaggc agaagccgtt cttgcgcgcg ctcatgaagg ttcgacagga      1080
     aagccgctgc agagcttcat gacgccggga tatctcgata cacgcgtcta cgcgctctac      1140
     gacaagattc cggccctctg ctatgggccg atctccgaaa acatccacgg cttcgatgag      1200
     cgcgtcagta tcgcctcgct gaagcgcatc accggcacca tggcgctttt tgttgccgaa      1260
     tggtgcggcg tggagccgat caagacatgg ccccgatgcc atggcggttg a               1311
//

If you have problems or comments...

PBIL Back to PBIL home page