(data stored in ACNUC7421 zone)

EMBL: CP000690.PE58

CP000690.PE58        Location/Qualifiers
FT   CDS_pept        67234..67698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3351"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3351"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28962"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTN0"
FT                   /protein_id="ABQ28962.1"
FT                   /translation="MRLCHSPFSRRHHPLFVRAVQDQIEQLWFRPSARPPDPSAAQSLE
FT                   SFRRFTAASEAGDLVAVRSESGGQVRFWLTNIDGLSRARGLLFTEDWPEFGDHAWLLAT
FT                   GRNAFCPDGQDRLVIPTAAVIRFIEEFPHGVAIDASSSRAALLSPDMASG"
     atgcgccttt gccatagccc attctcgagg cggcatcacc cactctttgt cagagcggtt        60
     caggatcaga tagagcagct ttggtttcgc ccgtctgccc gtccccccga tccgtccgcc       120
     gcgcagagcc tcgagagctt ccgacgcttc acggccgcga gcgaggctgg cgacctggtg       180
     gcggtaagga gcgagagcgg cggccaggtc cggttctggc tgacgaacat cgacgggctt       240
     tcccgcgcgc gcggcctcct cttcaccgag gactggccgg aattcggcga ccatgcctgg       300
     ctgctcgcga ccggacggaa cgccttctgc ccggacggcc aggaccggct ggtcatcccg       360
     accgcagcgg tcatccgctt catcgaggag ttcccgcacg gcgtcgcgat cgatgcgtca       420
     tcgagcaggg ccgcgctcct ttcgcccgac atggcctccg gctag                       465
//

If you have problems or comments...

PBIL Back to PBIL home page