(data stored in ACNUC7421 zone)

EMBL: CP000690.PE6

CP000690.PE6         Location/Qualifiers
FT   CDS_pept        9556..11154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3298"
FT                   /product="Integrase, catalytic region"
FT                   /note="PFAM: Integrase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3298"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28910"
FT                   /db_xref="GOA:A5FTH8"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTH8"
FT                   /protein_id="ABQ28910.1"
FT                   /translation="MPPQPGGVLARAPPWSRPSGPRRIPRHNGETFVPGRHINDHQKRL
FT                   FMRYRQTDGVALAAAKAGFSTAAGYRLEQERHLPSSPKPPRGRRRPDPLATIFDAEVVP
FT                   LLEAAPGLRAVAIFEEMCRRHPDLAPGVRRTLERRIRTWRALHGPEQEVIFRQTHEPGA
FT                   MGLSDFTDMNELGIIVAGAPLDHRLYHFRLVWSGFEHAHVILGGESYVALAEGLQNALW
FT                   LLGGAPREHRSDSLSAAFRNLTAENVADLTRRYDALCTHYGMTPSRNNRGVAHENGAIE
FT                   SPHGHLKRAVRDALLLRGSTVFVDLEAYRRFIAEIVGRQNRRHAERIDAERAALQKLPD
FT                   QRTADYEETVVTVTSSGGFTLRKVFYTVPSRLIGQRLRVRLYDNRLELFLAATPLMTLP
FT                   RGRPQPDGRHGHVVDYRHVIHSLRRKPMALLNLVYRHQLFPRDAYRRTFEHLLEQTPPR
FT                   DACRIMVELLAIAHERACEAELASVLAADIKAGRQPDLKAIRQRFAPDPASLPALTIPT
FT                   MPLASYDILLQGAAA"
     gtgcctcccc agccgggcgg cgtccttgcc agggcgccgc cgtggtcgcg gccgtctggg        60
     ccgcggagga tacctcgtca caacggggag accttcgtgc ccggccgcca catcaacgat       120
     caccagaaga ggcttttcat gagatatcga cagacagacg gcgttgccct ggcggccgcc       180
     aaggccggct tcagcacggc cgcgggctac cggctcgagc aggagcggca cttaccgtca       240
     tcgccgaagc cgccgcgcgg ccggcgccgc ccggatccgc tggcgacgat cttcgacgct       300
     gaggtggtgc cgctgctgga agccgcgccc ggcctcaggg ccgtggcgat cttcgaggag       360
     atgtgccggc ggcatcccga tctcgccccg ggtgtccggc ggacgctcga gcggcgtatc       420
     cgcacctggc gcgcgctgca cgggccggag caggaggtca tctttcgcca gacccatgag       480
     ccgggcgcga tgggcctgtc cgacttcacc gacatgaacg agctcggcat catcgtcgcc       540
     ggcgccccgc tcgaccaccg gctctatcac ttccgcctgg tctggtccgg cttcgagcac       600
     gcccatgtca tcctgggcgg cgagagctac gtcgccctcg ccgaggggct tcagaacgcc       660
     ctctggcttc tgggcggcgc cccgcgcgaa catcgcagcg acagcctctc cgccgccttc       720
     cgcaacctca ccgccgagaa cgtcgccgac ctgacccgcc gatatgacgc gctctgcacc       780
     cattacggca tgaccccgtc gcgcaacaat cgcggtgtcg ctcatgagaa cggcgccatc       840
     gaaagccccc acggccatct caagcgcgcg gtccgcgacg cccttctcct gcgtggcagc       900
     acagtcttcg tcgatctcga agcctatcgc cgcttcatcg ccgagatcgt cggccgccag       960
     aaccggcgcc acgccgagcg catcgacgcc gagcgcgccg ccctgcagaa actccccgat      1020
     cagcgcaccg ccgattacga ggagaccgtc gtcaccgtca cctcctccgg cggcttcacc      1080
     ctcaggaagg tcttctacac cgtcccctcc cgcctgatcg gccagcggct ccgcgtccgc      1140
     ctctatgaca accggctcga gctgttcctc gccgccaccc cgctgatgac actcccccgc      1200
     ggccggccac aaccggatgg caggcacggc cacgtcgtcg actaccgcca cgtcatccac      1260
     agcctgcgcc gcaagccgat ggcgctgctc aatctcgtct atcgccacca gctcttcccg      1320
     cgcgatgcct atcgccggac cttcgagcac ctgctcgagc agacaccgcc cagggacgcg      1380
     tgcaggatca tggtcgaact cctcgccatc gcccatgagc gcgcctgcga ggctgaactc      1440
     gccagcgtcc tcgccgccga tatcaaagcc ggccgtcagc ccgacctcaa ggccatccgc      1500
     cagcgcttcg cacccgatcc tgccagcctg cccgcactca ccatcccgac catgccgctc      1560
     gccagctatg acatcctgct ccagggagca gccgcatga                             1599
//

If you have problems or comments...

PBIL Back to PBIL home page