(data stored in ACNUC7421 zone)

EMBL: CP000690.PE60

CP000690.PE60        Location/Qualifiers
FT   CDS_pept        complement(68322..68723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3353"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3353"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28964"
FT                   /db_xref="GOA:A5FTN2"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTN2"
FT                   /protein_id="ABQ28964.1"
FT                   /translation="MIDQESSADLLIHFGQLIRKVRISFGVRQADLAAMVGTRQATISE
FT                   LERGRLNIHLDLALNLMRHLGIEIREPEAHSDDAQITEEAMSVPDIDNIIPPPSRRTPC
FT                   NPEAGLPTSSAPSDQNGDPADDPPAEPAP"
     atgatcgacc aagagagctc tgcagatcta ctgatccact tcgggcagct gatccggaaa        60
     gtccgcatct ctttcggtgt ccgtcaagcc gacctggcgg ccatggttgg aacacgccag       120
     gcaacaatat ccgaacttga gcgcggccgg ctgaacatcc acctcgatct ggccctgaac       180
     ctgatgcggc atctcggcat cgaaatcagg gagccggaag cgcacagcga cgatgcgcag       240
     attacagagg aggccatgag cgtgccggat atcgacaaca tcataccgcc gccttcgcga       300
     cgtacgccgt gcaatccaga agctgggctg cccacctctt ctgcaccctc agaccagaat       360
     ggagacccgg ccgatgaccc gccggccgaa ccggcgccct ga                          402
//

If you have problems or comments...

PBIL Back to PBIL home page