(data stored in ACNUC7421 zone)

EMBL: CP000690.PE61

CP000690.PE61        Location/Qualifiers
FT   CDS_pept        complement(68839..69462)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3354"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3354"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28965"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTN3"
FT                   /protein_id="ABQ28965.1"
FT                   /translation="MLSTSGYRRLVGDLADARCIWPVNRRLYLNREASPAAGPDEAAEH
FT                   LEPGAIVSLQRVLGAHGILNNPSAYVTAVVPLRTGHPPPTLGHRATEAGVFVFKGIPAA
FT                   VLAAGEEEDRLEALNRPFPGRMPIATPEKALIDWIYLGSSPRSDMLLPPIHDIDLETLD
FT                   RERLGRLAKAAGPAVEAAVSAWMEKADQHVHYDDREDDGPIPGF"
     atgctgtcga cgagcggata ccgccggctc gtgggcgacc ttgcggatgc ccggtgcatc        60
     tggccagtca accgccggct ctacctgaac cgcgaggcat ccccggcggc cgggccggac       120
     gaggcggccg aacacctcga gccgggggcc atcgtgtctc tgcagcgcgt cctcggcgcg       180
     cacggcatcc tgaacaaccc ctccgcctat gtcaccgcgg tcgtgccgct caggaccggc       240
     catccgccgc caacccttgg gcaccgcgcg accgaggccg gcgtgttcgt cttcaagggg       300
     atccccgccg cggtgctcgc ggctggtgag gaagaggacc gtctggaggc cctcaaccgg       360
     ccattccccg gacgcatgcc gatcgcaacg cccgagaagg cgctcatcga ctggatctac       420
     ctcggcagct cgccccgatc cgacatgctc ctcccgccga tccacgacat cgacctcgaa       480
     acactggacc gggagcggct gggccgcctg gcgaaggcgg ccgggccggc cgtcgaagcc       540
     gccgtgtccg cgtggatgga gaaggcagac cagcatgtcc actacgacga ccgggaggat       600
     gacgggccaa taccggggtt ctga                                              624
//

If you have problems or comments...

PBIL Back to PBIL home page