(data stored in ACNUC7421 zone)

EMBL: CP000690.PE62

CP000690.PE62        Location/Qualifiers
FT   CDS_pept        complement(69561..70400)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3355"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3355"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28966"
FT                   /db_xref="InterPro:IPR014942"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTN4"
FT                   /protein_id="ABQ28966.1"
FT                   /translation="MTVSSLIRGTPNDADVARELLQYEVVRSIFVKSTEREIALKGGFA
FT                   MRALFGSARHTKDIDLQHDARRANLARTQTLIRSAIRNAVATGILEDVRISEPKQTDTV
FT                   ARWKIGGRTVGGSQVALTIEVSRRPMPGDDCLTRMEMQPPAEIGGALVMVDTYSADAMA
FT                   GAKTIALLSENRLAPRDLWDLDILITMRAEPPPHMIDHLRTERARQALFDKLDTMSWKL
FT                   FREEVLPTLPAGVAEALDRDAFEEMKVRVALAVEKWLADGDRSPDRRPDNQEPGPTP"
     atgactgttt ccagcttaat caggggtacc ccgaacgatg ccgacgtcgc gcgggaactg        60
     cttcaatacg aggttgtgcg gagcatattc gtgaaatcga ccgagcggga gatcgcgctg       120
     aaaggtggat ttgccatgcg cgcgctgttc gggagcgcac ggcacaccaa ggacatcgac       180
     ctgcagcacg atgcgcggcg ggccaacctg gcgcgcaccc agacgctgat ccggtcggcc       240
     atccgcaacg ccgtagccac gggcattctc gaagacgtcc ggatcagcga gccgaagcaa       300
     accgacaccg tggcgcggtg gaagatcggc ggccggactg tcggaggttc tcaggtcgcg       360
     ctcaccatcg aagtgtcgcg ccggccgatg ccgggggatg attgcctgac caggatggag       420
     atgcagccac cggccgaaat cggcggcgcc ctcgtgatgg tcgacaccta ttccgcggat       480
     gccatggccg gagccaagac aatcgcgctg ctcagcgaga accggctggc gccgcgtgac       540
     ctgtgggacc tcgacatcct catcaccatg cgggcggagc caccgccgca catgatcgat       600
     cacctgcgca ccgagcgtgc ccggcaggcg ctgttcgata agctggacac catgagctgg       660
     aagctcttcc gcgaggaggt gctgccgacc ctgccggccg gcgtggcgga ggcgttggac       720
     cgggatgcgt tcgaggagat gaaggtccgg gtcgcgctcg ccgtcgagaa atggctggcc       780
     gacggagacc ggagccccga tcgccggccg gataaccagg agccaggccc gacaccatga       840
//

If you have problems or comments...

PBIL Back to PBIL home page