(data stored in ACNUC7421 zone)

EMBL: CP000690.PE63

CP000690.PE63        Location/Qualifiers
FT   CDS_pept        complement(70677..70916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3356"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3356"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28967"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTN5"
FT                   /protein_id="ABQ28967.1"
FT                   /translation="MLQFELRAFPNEAMGPEDRTFVQAPSDQAIRARAGRLAVRINGPV
FT                   DIARAGGADWNDRYLTTANPSEYHAAGYRFERLT"
     atgctgcaat tcgagttgcg cgcctttccg aatgaggcga tgggccccga ggacagaact        60
     ttcgtccagg cgccaagcga tcaggccatc cgggcgcggg cgggccggct cgccgtcagg       120
     atcaacggac cagtcgatat cgcgcgtgct ggtggggccg actggaacga ccgctacctg       180
     accaccgcca accccagcga ataccacgcc gccggctatc gcttcgagcg gctgacatag       240
//

If you have problems or comments...

PBIL Back to PBIL home page