(data stored in ACNUC7421 zone)

EMBL: CP000690.PE65

CP000690.PE65        Location/Qualifiers
FT   CDS_pept        complement(71903..73144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3358"
FT                   /product="filamentation induced by cAMP protein Fic"
FT                   /note="PFAM: filamentation induced by cAMP protein Fic"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3358"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28969"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="InterPro:IPR040198"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTN7"
FT                   /protein_id="ABQ28969.1"
FT                   /translation="MREFPGSLTLMPEEGRAGYGHLLDLSFSLAAESAELGGMMRAPTR
FT                   RAIARLVRAMDCYYSNLIEGREARPKDIQRALSENYSSDPAVRDKQVEARAHIKVQERI
FT                   DDGAYDRLGLGTELIRSIHKDFYLHMPESFRSVELNGVRHRVVPGEFRNLYVVVGRHEA
FT                   VAPEMVPGFMAHFEAGYRGVGPAFSLIAAAASHHRLAWIHPFLDGNGRTARLYTHAWFR
FT                   RFTKGADLWSVSRGLARTLGDYRSKLARADYPPQGGTDGRGTLSASGLAEFCAYFLETA
FT                   LDQVRFMRDMLAPDTLLPRLRLFVQHEAEAGRLDPRAFAILELAYLRGHVPKGEVETLL
FT                   GVSERHARRIVTPLVEQGLLESEGRSAPFTIGFPLEEADLVFPRLFQMPAAATQAKFLD
FT                   AVRSDDAVDDMPAP"
     atgcgtgaat ttcctggttc cctgaccttg atgccggaag aggggcgcgc aggttatggc        60
     cacctgctcg acctgtcctt cagcctcgcg gcggagtcgg cggagcttgg cgggatgatg       120
     cgggctccga caagacgcgc catcgcgcgg ctcgttcggg cgatggactg ctactacagc       180
     aacctgatcg aggggcgtga ggcgcgcccg aaagacatcc agcgcgcact gtcggagaat       240
     tactcgtctg atccggccgt ccgggacaag caggtggagg cgcgtgcgca catcaaggtc       300
     caggaacgga tcgatgatgg agcctatgat cgccttggtc tcggcacgga gttgatcagg       360
     tcgatccaca aggacttcta cctgcacatg ccggaatcgt tcaggtcagt ggagctgaac       420
     ggagttcggc accgcgtcgt gccgggcgag ttccggaacc tgtatgtggt ggtgggacgt       480
     cacgaggcgg tcgcgccgga gatggtgcct gggttcatgg cacatttcga ggccggctat       540
     agaggcgtcg gacccgcctt ctccctgatc gccgcagcgg cctcacatca ccggctggcc       600
     tggatccatc ccttcctcga cgggaatggc cgcaccgcgc gcctctacac ccatgcctgg       660
     ttcaggcgct tcacgaaggg agcggatctc tggtcggtgt cgcggggcct agccaggacg       720
     ctcggtgatt accgctccaa gctggcgcgg gccgactatc cgccacaggg gggcaccgat       780
     ggccgcggca cgctatccgc gtctggcctc gcggagttct gcgcgtattt cctcgagact       840
     gctctcgatc aggtccggtt catgcgtgac atgctggctc cggacaccct gcttccgcgg       900
     ctcaggctgt tcgtccagca tgaggccgag gccgggcgcc tcgatccccg ggcgttcgcc       960
     attctcgagc tggcctatct gcgtgggcat gtgccgaagg gggaagtcga gaccttgctt      1020
     ggcgtgtccg aacggcacgc gcgccgcatc gtcacgccgc tggttgagca gggcctcctt      1080
     gaatccgaag gtcgatcggc ccccttcacg ataggctttc cgctggagga ggcagatctc      1140
     gtcttcccgc gcctgttcca gatgccggca gctgctactc aggccaaatt ccttgatgct      1200
     gtccgctcgg atgatgcggt ggatgacatg ccggcgccct ga                         1242
//

If you have problems or comments...

PBIL Back to PBIL home page