(data stored in ACNUC7421 zone)

EMBL: CP000690.PE66

CP000690.PE66        Location/Qualifiers
FT   CDS_pept        complement(73293..74399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3359"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3359"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28970"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTN8"
FT                   /protein_id="ABQ28970.1"
FT                   /translation="MLLCDQVVAMRNRILAVPGALQAATSSIQRIVSVADTLPSAPRFI
FT                   LANDVTEALITSSIDYPEALTGCIDAIRIPWRCAWFEWDDDFARDTWRRAHVRQRVQDD
FT                   NFMPKRVGFIVETDEGGRRGEISVLWPVPESDGKGGLTSNYDGMVMSNLPTVHFDLDRQ
FT                   DLDARVMVGAASLERATGIPIPEIGFNNELEPGRARYLDRIRATMMMDWSNSGVAKLIT
FT                   HLGHYNPVEFVSNAVADIWSEYCMLVPAAAMMNARQAVRTAPVDRTRLNKARLKSGRSP
FT                   LLDHQVVSMNVSPEERAERRRVAAGGAARPRATHWVRGHLVHRGGTIFWRRPHIRMGVG
FT                   DVPVGRTVRVHGQPEIRPEVDDMPAPGQ"
     atgcttctgt gtgatcaggt cgtcgcgatg agaaacagga tcctcgctgt cccgggagcg        60
     ctgcaagcgg cgacttcctc gatccagcgg atcgtctcgg tcgcggacac gctgccctcg       120
     gcgccgcgct tcatcctggc caacgacgtg acggaggcgt tgatcaccag ctcgatcgac       180
     taccccgagg cgctcaccgg ctgcatcgat gcgatccgga ttccgtggcg gtgcgcctgg       240
     ttcgagtggg atgacgattt tgcccgggat acctggcggc gggcgcatgt ccgccagcgg       300
     gttcaggatg acaatttcat gccgaagcgg gtcggcttca tcgtcgagac cgacgaaggc       360
     ggtcggagag gcgagatttc cgtgctctgg ccggtgccgg agtccgacgg caagggcggc       420
     ctgacaagca actacgacgg catggtgatg tcgaacctgc ccacggtcca cttcgacctc       480
     gaccggcagg atctcgacgc tcgggtcatg gtcggagccg cttccctcga gcgtgcaacc       540
     gggattccca tcccggagat cgggttcaac aatgagcttg aaccagggcg agctcgctac       600
     ctcgaccgga ttcgagccac gatgatgatg gactggagca attccggggt cgccaagctc       660
     attactcatc tgggccacta caatccggtc gaattcgtct cgaacgccgt cgcggacatc       720
     tggtcggagt actgcatgct ggtccccgcc gcggcgatga tgaatgcccg gcaggcggtg       780
     cgcacggccc cggtcgaccg cacccggctc aacaaggccc ggctgaagtc aggccggagt       840
     cccctgctcg atcaccaggt cgtgtcgatg aacgtctcgc cggaggagcg tgccgagcgc       900
     cggcgggtgg ccgcaggtgg tgcggcacgt ccgcgcgcga cgcactgggt gcgcggccat       960
     ctggtccatc gtggcgggac gatcttctgg cgccggccac atatccgcat gggggttggc      1020
     gacgtaccgg tcgggcggac ggtccgggtg cacggacagc cggagattcg acccgaggtg      1080
     gacgacatgc cggcgcctgg ccagtga                                          1107
//

If you have problems or comments...

PBIL Back to PBIL home page