(data stored in ACNUC7421 zone)

EMBL: CP000690.PE67

CP000690.PE67        Location/Qualifiers
FT   CDS_pept        74540..75703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3360"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28971"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTN9"
FT                   /protein_id="ABQ28971.1"
FT                   /translation="MSGQSQSGQSGQTSQARPEAADREHYVWHHMRQPNGFTCGSTCVR
FT                   MLSSILLAGEPDPPRLHPEVIAGMMGTSPRTGTTEIEMKRGLDLYGIPHERMPPTADGA
FT                   GPGRMEDLIGWLKAGNMAMLRCLFFGMKHWILATHADARGIHVLDPAAQSPGILSPDRV
FT                   ASLIQPRGWEFWKIPANAPCRELHFGRLPRPGIATEVMQDAVVGLLLDHGDLDRRMIPP
FT                   EAAGWLVGQLMRSERSYGLWDGNRLLATHIASGCQPWKVLEDAGFTVDEATMERLRAQL
FT                   ARLPGAVYHSLATAVHPDVEENGGRWLVDAAPGLFGFAGVHGIERADEAAGGRAGDTLL
FT                   ELRHDEMRYFVREAPNFDGVAALEEVVTGPTRGPSDEDAQGPGPSPG"
     atgagcggtc aaagtcagtc cggccagtcc ggccaaacca gccaggcccg cccggaagcg        60
     gccgatcgcg agcactatgt gtggcaccac atgcggcagc cgaacggctt cacctgcgga       120
     tcgacctgcg tgcgcatgct ttccagcatc ctccttgctg gcgagcccga tccgccgcgc       180
     ctccatcccg aggtcatcgc cggcatgatg gggaccagcc cccggaccgg gacgacagag       240
     atcgagatga agcgcggcct cgatctctat ggcatcccgc acgagcggat gccgccgacc       300
     gcagacggtg cggggccggg ccggatggaa gacctgatcg gctggctgaa ggccggcaac       360
     atggccatgc ttaggtgcct cttcttcggc atgaagcact ggatcctcgc gacccacgcg       420
     gacgctcggg gaatccatgt cctcgatcca gccgcccaga gtcccggcat cctctccccc       480
     gaccgcgtcg cctcgctcat ccagccgcgt gggtgggagt tctggaagat cccggccaac       540
     gcgccctgcc gggagttgca tttcggccgg ctgccaagac ccggcattgc gaccgaggtg       600
     atgcaggacg cggtcgtggg gctcctcctc gatcatggcg acctcgatcg gcggatgatc       660
     ccgcccgagg cagccggctg gctcgtcggg cagcttatgc gctccgaacg gagctatggc       720
     ctgtgggacg gcaaccggct cctggctacc cacatcgcca gcggctgcca gccgtggaag       780
     gtcctcgagg atgccggctt cacggtcgac gaggcgacca tggagcgtct tcgcgcccag       840
     ctcgcccgcc tgcccggcgc ggtctaccat tcgctcgcca ccgcagtgca tccggacgtc       900
     gaggaaaatg gcggccgatg gctggtcgat gccgcgccag ggctcttcgg ctttgccggc       960
     gtccacggca ttgagcgcgc cgatgaggca gccgggggga gggctggcga cacgcttttg      1020
     gagctccgcc atgacgagat gcgatacttc gtccgggagg cgccgaattt cgacggagtg      1080
     gccgctcttg aagaggttgt gacgggcccg acacgcgggc cgtccgatga agatgcgcag      1140
     gggcccgggc catctccggg gtga                                             1164
//

If you have problems or comments...

PBIL Back to PBIL home page