(data stored in ACNUC7421 zone)

EMBL: CP000690.PE68

CP000690.PE68        Location/Qualifiers
FT   CDS_pept        complement(75757..76203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3361"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3361"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28972"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTP0"
FT                   /protein_id="ABQ28972.1"
FT                   /translation="MLRPLLRQVEDAKVLSSDACGAEGISICLTDARDTETGAPFIACR
FT                   LNEGGVVAVSGYGMIFVAPPWRGLGLGAELSLYSRMLEDDDGHGAHLYSPGGLAAAISG
FT                   YELGCRIGADLGYHDRLADVMIDAGLMRRRYGLDRPRGSPSPEA"
     atgctgcggc cccttttacg gcaggtggaa gatgcgaagg ttctctcgtc ggatgcctgc        60
     ggggcggagg ggatttccat ctgcctcacc gatgctcgtg acaccgagac aggggcaccc       120
     ttcattgcat gccgcttaaa cgaggggggc gtcgtcgccg tttcaggtta cggcatgatt       180
     ttcgtcgctc ctccgtggcg gggcctgggt ctcggcgccg aactctccct ctattccagg       240
     atgctggagg atgatgacgg gcatggagcg cacctctact ctccgggcgg cctggctgcg       300
     gccatcagcg gctatgagct cgggtgccgg atcggcgctg atctcggcta tcatgaccgg       360
     ctggccgatg tcatgatcga tgctggcctg atgcgcaggc gctacgggct tgatcggcca       420
     cgcggatcgc catcaccgga ggcgtag                                           447
//

If you have problems or comments...

PBIL Back to PBIL home page