(data stored in ACNUC7421 zone)

EMBL: CP000690.PE69

CP000690.PE69        Location/Qualifiers
FT   CDS_pept        complement(76365..76922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3362"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3362"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28973"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTP1"
FT                   /protein_id="ABQ28973.1"
FT                   /translation="MPNYYSTVAVHEPLPLALLSTLEREILGAAFQDAQPDGELIHLFA
FT                   SETAGGFLEMRLSELRKAFENLPDRATGVGRTLAAPLEAAAAGGSGDDDMVTVDIDEDA
FT                   WLSVLQDISARMPQQMIRVTAAWTCSKPEPQATGGSAMLVTPKSIFRGSTDSLMAQFID
FT                   EASQEIGHLDEVTPEPGPEPQP"
     atgcccaact attacagcac cgtcgccgtt catgagccgc tgccgctggc tttgctttcc        60
     acgttggagc gcgagatcct gggcgccgcc tttcaggatg cacagccgga cggtgagttg       120
     attcatctgt ttgccagcga gacggccggg ggtttcctgg agatgcgtct ctcggagttg       180
     cgcaaggcat tcgagaacct tccggacagg gccaccggtg tcggccgcac cctcgccgct       240
     ccactggaag ccgcggcggc tgggggcagc ggcgacgatg acatggtcac ggtcgatatc       300
     gacgaggacg cgtggctgtc ggtgctgcag gacatctccg cgcgcatgcc ccagcagatg       360
     atccgggtca cggcggcctg gacctgcagc aagcctgagc cgcaggccac tggcggcagc       420
     gcgatgctgg tcacgccgaa gtcgatcttc cgcggcagca cggacagcct gatggcgcag       480
     ttcattgacg aggccagcca ggagatcgga catcttgacg aggtcacgcc ggagccgggg       540
     cccgagccgc agccgtga                                                     558
//

If you have problems or comments...

PBIL Back to PBIL home page