(data stored in ACNUC7421 zone)

EMBL: CP000690.PE7

CP000690.PE7         Location/Qualifiers
FT   CDS_pept        11151..12026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3299"
FT                   /product="IstB domain protein ATP-binding protein"
FT                   /note="PFAM: IstB domain protein ATP-binding protein;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3299"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28911"
FT                   /db_xref="GOA:A5FTH9"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTH9"
FT                   /protein_id="ABQ28911.1"
FT                   /translation="MSETARTVDAQRLTLLLNELRLPAIKQVWPDFAARADKEAWPAAR
FT                   LLATLAEHEVAERDRRRIERHLLEARLPPGKTIATFTFEAVPMISKAQILALCSGDGWL
FT                   ETGANLLAFGPPGGGKSHLAAAIGLALVENGWRVLFTRTSDLVQKLQIARRELALEATI
FT                   AKLDKFHPLILDDLAYVTKDQAETSVLFELISARYERRSLMITANQPFGEWGKVFPDPA
FT                   MTLAAVDRLVHHATIFEMNVESYRRKTAIQRRAGPGRPPTRATINENIRLSLHDNQVAE
FT                   TRLPASNQSD"
     atgagcgaga ccgcacgcac cgtcgacgcc cagcgcctta ccctgctgct caacgagctc        60
     aggctccccg ccatcaagca ggtctggccc gacttcgccg cccgcgccga caaggaagca       120
     tggcccgccg cacgcctcct cgccacgctc gccgagcacg aggtcgccga gcgcgaccgc       180
     aggcgcatcg agcgccacct cctcgaagcc aggctgccgc ccggaaagac catcgccacc       240
     ttcaccttcg aggccgtgcc gatgatctcc aaggcccaga tcctcgccct ctgctccggc       300
     gacggatggc tcgagaccgg cgccaatctc ctcgccttcg gcccacccgg cggaggaaag       360
     tcccatctcg ccgcagccat cggcctcgcc ctcgtcgaga atggctggcg cgtgctgttc       420
     acccgcacct ccgacctcgt ccagaagctc cagatcgcac gtcgtgaact cgccctcgag       480
     gccaccatcg ccaagctcga caaattccac ccgctgatcc tcgacgacct cgcttacgtc       540
     accaaggatc aggccgaaac ctcggttctc ttcgaactca tcagcgcacg ctacgagcgt       600
     cgctccctga tgatcaccgc caaccagccc ttcggtgagt ggggtaaggt cttcccagat       660
     cccgccatga cactcgccgc cgtcgaccgc ctcgtccacc acgccaccat cttcgagatg       720
     aacgtcgaaa gctatcgccg caaaaccgcc atccaacgac gagccggacc aggacgccca       780
     cccacacgcg cgacaatcaa cgaaaacatc agattgtcgc tccacgacaa tcaagtcgcc       840
     gaaacacgct tgccagcatc aaaccaatcc gattaa                                 876
//

If you have problems or comments...

PBIL Back to PBIL home page