(data stored in ACNUC7421 zone)

EMBL: CP000690.PE71

CP000690.PE71        Location/Qualifiers
FT   CDS_pept        78680..80134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3364"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3364"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28975"
FT                   /db_xref="GOA:A5FTP3"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024023"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTP3"
FT                   /protein_id="ABQ28975.1"
FT                   /translation="MASFLKPEAFEPDPRAMRLLPFRFERISDDVVIISNFVGELMFAT
FT                   DNEMSRLVSLDLKPGDGLFERAREKLLVSVGSERAPLELLALRLRSRLAFLRNPTPLHI
FT                   FVVTLRCEHSCPYCQVSRQSSDRNQFDMSDETAMRAIDVAMSTPGDSLKIEFQGGEPLL
FT                   NFDLIQRVVDVASKEAVSLGKSVQFVIASNLAMLDDDILDFCKQRSVLISTSLDGPADL
FT                   HNRNRPRPGGNSHELAVRNIQRAQGVLGRDRVGALMTTTEASLDRAEEIIDEYLALGLE
FT                   GIFLRPLSPYGFAMKTRQFSKYDGEAWFRFYVRGLKYILEINKSGRRFPEFYASLLLRR
FT                   MLTDRADGYVDLRSPMGAGLGTLVYNYDGDVFASDEGRMLAEMGDRTFKLGNLASADYA
FT                   KLALSEKLIDLASRSLTQSAPQCSSCAFEPHCGADPVYHHATQGDPVGIKRFSEFCGRQ
FT                   KRIIGFLANLLEKSPDDAAILRGWAS"
     gtggctagtt ttctcaagcc tgaagccttt gaaccagatc cgcgggcaat gcggcttctg        60
     ccgtttcggt ttgaacgtat ctcggatgac gttgttataa tttcgaattt tgttggcgag       120
     cttatgtttg ccacagataa tgaaatgagt cggttagttt cactcgatct aaagccggga       180
     gatggactgt tcgagcgtgc tagggaaaaa ttacttgttt ctgttgggag cgaacgggcg       240
     cccctcgaac tccttgccct acgcctccgg agtcgcttgg cttttcttcg taaccccacg       300
     cccctacaca tctttgtcgt gacattgcgt tgcgagcact cgtgcccgta ctgccaggtc       360
     tcgcgtcaga gttccgatcg aaaccagttt gacatgtcgg atgaaaccgc gatgcgagcg       420
     atcgacgtgg ctatgtcgac gccaggcgac agcctcaaga tagaattcca aggaggggaa       480
     cccttactca atttcgatct tattcagcga gtagtagacg tggcgagcaa ggaggccgtc       540
     agcctcggca aaagcgtgca attcgtgatt gcgtcgaacc ttgcgatgct agacgatgac       600
     atcctcgact tttgcaagca gcggtcggtt ctaatttcaa cttcactcga tggtcccgcg       660
     gatctacaca atcggaatcg tccccgcccc ggcgggaata gccatgagct tgccgtgcgt       720
     aacatccagc gagcacaggg cgtgctcgga cgggaccgag ttggcgcgct gatgacaacg       780
     actgaagcaa gcttggatcg tgctgaagag ataatcgatg agtatttggc actcggacta       840
     gagggaatat ttttgcgccc actttccccg tatggatttg ctatgaaaac ccggcagttc       900
     tccaaatatg acggcgaggc ttggtttcga ttttatgtgc gtgggctaaa atacatcctc       960
     gaaatcaata aatcgggccg ccgctttcca gagttttatg cgtcgctgct cttgcgacgt      1020
     atgcttactg accgcgcaga tggctacgtc gatctacgca gcccgatggg ggccggctta      1080
     ggcaccttgg tatataatta tgatggagac gtattcgcgt ccgacgaggg acgtatgttg      1140
     gcggaaatgg gcgacagaac attcaagctt ggcaatcttg cctccgccga ctacgcgaaa      1200
     ttggcactgt ccgagaagtt gattgatctg gcgagtcggt ccttaacgca gtctgcgcca      1260
     caatgttcat cctgcgcgtt tgagccgcac tgtggggccg atccggttta tcatcatgcc      1320
     acgcagggcg atccggttgg cattaagcgg ttttcggaat tctgcggccg ccaaaagcgc      1380
     atcattggct ttctggcgaa tctcttggaa aagtcgccag atgatgcggc gatattgcgg      1440
     gggtgggcgt cgtga                                                       1455
//

If you have problems or comments...

PBIL Back to PBIL home page