(data stored in ACNUC7421 zone)

EMBL: CP000690.PE72

CP000690.PE72        Location/Qualifiers
FT   CDS_pept        80122..81303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3365"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3365"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28976"
FT                   /db_xref="GOA:A5FTP4"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024032"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTP4"
FT                   /protein_id="ABQ28976.1"
FT                   /translation="MGVVTPLALAGRAITICWSNVSANRFIVRVQDPASCAQGPADAAL
FT                   IRSVDDAENAKRSGFKSAVGIGLSTDKATGFDQLILLDGRFDYLSDGDILRVHPNTNHI
FT                   RTLYRRASQHNAFLVTERCNHWCLMCSQPPRNVSDGWIIDEIAECFPLLNPQPRSLGFT
FT                   GGEPMTDWERFINLLSLAKDQLPSVALHVLTNGRAFAKPPIAVAWAALRHPSLTAGIPI
FT                   YAAAGHLHDYIVQSMGAFDETVMGILRLKDQGQRVEVRVVLHALSVPRLVETAIWLGRN
FT                   LPFVDHVALMGLEQTGFAIANQDQLWIEPTEYAAQLAEAVLILQSAGIRVSVYNLPLCL
FT                   LPRPVWPASVQSISDWKNGFLPECEECAKRGDCPGFFSSGRKAVGRKVRPIKL"
     gtgggcgtcg tgacaccact ggctctcgcc gggcgggcaa ttacaatatg ttggagtaac        60
     gtatccgcta accgcttcat cgtgagggta caagatcctg catcttgcgc ccaaggtcca       120
     gccgatgcag cgttaattcg ctcggttgat gatgcggaaa acgcaaagag gtccggtttt       180
     aagtcagccg tcggcattgg gttatccacc gataaggcga ctggctttga ccaactcata       240
     ctcctcgacg gccgcttcga ttatctgtct gatggtgaca tccttcgcgt ccacccaaat       300
     acgaatcata tccgcaccct ttatcgcaga gcgtcacagc ataatgcatt tcttgtaaca       360
     gagcggtgca atcactggtg cttgatgtgc tcacagccgc cacggaatgt ctcagacggt       420
     tggatcatcg acgaaattgc agagtgtttc ccactcctta acccgcaacc tcggtctcta       480
     gggttcaccg ggggagagcc gatgaccgat tgggagcgat ttatcaactt attatccttg       540
     gctaaagatc aacttccatc ggtcgcactc cacgtactga caaatgggcg ggcatttgca       600
     aagcccccaa tcgccgtagc ctgggccgcc cttcggcatc cgagcctgac cgcaggcatc       660
     ccgatatacg cggctgccgg acatctccat gactatatcg tgcaaagtat gggcgccttc       720
     gatgagacgg tcatgggtat ccttcgcctc aaggatcagg gacagcgcgt ggaggtgcgg       780
     gttgttctgc atgcgcttag cgtacctcga ttggtcgaga cggcaatctg gctgggacgg       840
     aatctcccgt tcgtagatca cgtagcgcta atgggactcg aacaaacagg ctttgctata       900
     gccaatcagg atcaactctg gatcgagcca actgaatatg ccgcccaact cgccgaggcg       960
     gtcttgatct tacaaagcgc aggtatccgc gtctctgtct acaatttacc attatgcctc      1020
     cttcctcgac cagtttggcc ggcttccgtt cagtcgattt ctgattggaa aaatggattt      1080
     cttccggagt gcgaagagtg tgcgaagcgt ggggattgcc ctggcttttt ttcgagtggt      1140
     cgtaaagcgg tagggcgtaa ggtgcggccg atcaaattgt ga                         1182
//

If you have problems or comments...

PBIL Back to PBIL home page