(data stored in ACNUC7421 zone)

EMBL: CP000690.PE73

CP000690.PE73        Location/Qualifiers
FT   CDS_pept        81684..83159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3366"
FT                   /product="AAA ATPase, central domain protein"
FT                   /note="PFAM: AAA ATPase, central domain protein; ATPase
FT                   associated with various cellular activities, AAA_5"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3366"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28977"
FT                   /db_xref="GOA:A5FTP5"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027065"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTP5"
FT                   /protein_id="ABQ28977.1"
FT                   /translation="MTKASGNPTDDISGLLEDGIGVFDDAGELHVPLRRGRGGTPVAGT
FT                   RGDWGLEDPPAPPIVPAPGMNDRVSNWAARNIIAPAILAIIQPTGLDREQAGRVHDAVR
FT                   RLIPAGLPPGALNLHGAVKLLFGMEFRSLPLKTRCETLEMLLAWMGLTEEVGLEIFGED
FT                   IWRALPFHWNQRVAELDTSDDAVAPAEVAAGATDPRRDVATGVIVVREIGNSDNDSAKR
FT                   ADKAVTSLVQKPLPLFRSNRLDTFRERMVADFPHAATAIDDLYWDLTTRDHVAWTPRIL
FT                   VGNPGVGKTSFVEAACLVLEIPYLKYPCGGDTDSVSFRGASRKWSTTSPSLPLSLIASH
FT                   QIANPVIILDEIEKAGTSRYNGNLLDVLLGMMDRKQASGWYDPHVEAPIDLRHVNWLAT
FT                   ANSTKDLPPAIRDRFRMVSRIADPSAEHGPHLVKALLRQVVAERGPGAAMIEPLGLDEI
FT                   EAITGIWGGGSVRQLQTVLEHWLRQRDRSASRH"
     atgaccaagg cttccggcaa tccgaccgac gatatcagcg gcttgctgga agatggtatt        60
     ggcgttttcg acgacgctgg cgagcttcat gtgcccctgc gccgcgggcg tggcggtaca       120
     ccggtggcag gcacccgcgg cgactggggg ctcgaagatc cacccgcgcc accgattgtc       180
     ccggcgcccg gcatgaatga ccgggtctcg aactgggcgg cccgcaacat catcgcgccc       240
     gcgatccttg ccatcatcca gcccaccggg ctcgaccgcg agcaggccgg gcgcgtgcat       300
     gacgccgtgc gccggctgat cccggccggc ctgccgccgg gggccctgaa cctgcacggc       360
     gcggtcaaac tactgttcgg catggagttc cgctcgctgc cgctgaagac ccgctgcgag       420
     acgctcgaga tgttgctcgc gtggatgggg ctcaccgagg aggtcggcct cgagatcttc       480
     ggtgaggaca tatggcgagc gctgccgttc cactggaacc agcgcgtcgc cgagctggac       540
     acgagcgacg atgcagtcgc accggcggag gtggctgcag gcgcgaccga ccccaggcgg       600
     gatgtcgcca cgggcgtcat cgttgtgcgc gagatcggca acagcgacaa tgacagcgcg       660
     aagcgggcgg acaaggcagt gaccagcctg gtgcagaagc cgcttccgct gttccgctcg       720
     aaccgcctgg atacgttccg cgagcggatg gtggccgact tccctcatgc cgccaccgcg       780
     atcgacgatc tctactggga cctgacgacg cgcgatcacg tcgcatggac gccccggatc       840
     ctggtcggca acccgggggt cggcaagacc agcttcgtcg aggcggcctg cctggtgctg       900
     gagatcccct acctgaaata tccgtgtggc ggcgataccg actccgtctc gttccgcggc       960
     gcctcccgga aatggtccac cacctcgccg tcgctgccgc tgagcctgat cgcctcgcac      1020
     cagatcgcca atccggtgat catcctcgac gagatcgaga aggccggcac cagccgctac      1080
     aacggcaacc tgctcgacgt gctgctgggc atgatggacc gcaagcaggc gtccggctgg      1140
     tacgacccgc atgtcgaggc cccgatcgac ctgcgacatg tgaactggct ggccacggcc      1200
     aactccacga aggacctgcc gcccgcgatc cgtgaccggt tccggatggt gagccgcatt      1260
     gccgatccgt ctgccgaaca cggtccccac ctggtgaagg cgctgctccg gcaggtcgtg      1320
     gccgagcgcg gtccaggagc tgcgatgatc gagcctctcg gcctcgatga gatcgaggcg      1380
     atcaccggga tctggggcgg tggatccgtc cggcagctcc agacggtgct ggagcactgg      1440
     ctgcgtcagc gggaccggtc agccagccgg cattga                                1476
//

If you have problems or comments...

PBIL Back to PBIL home page