(data stored in ACNUC7421 zone)

EMBL: CP000690.PE74

CP000690.PE74        Location/Qualifiers
FT   CDS_pept        83313..83666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3367"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3367"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28978"
FT                   /db_xref="InterPro:IPR024467"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTP6"
FT                   /protein_id="ABQ28978.1"
FT                   /translation="MFNILQFSDHGYFAPQKIAKELKTSSEDVARSAGLGRDAVQRANR
FT                   VQSDRTQRRLREMVEILNKSTPRFGSLLMAYAWYRSQPLPGFSGQTPMQLVMHGRANEV
FT                   LEYLDAVDAGIHA"
     atgttcaata tcttgcagtt ctctgatcat ggctacttcg cgccgcagaa gattgcgaag        60
     gagttgaaaa cgtcgagcga agacgtcgcc cgctcggcgg gtctcggacg tgatgctgtg       120
     cagcgcgcca atcgggtcca atctgacaga acccagcgcc gtctgcgtga aatggtggag       180
     atcctgaaca agtctacacc acggttcgga tcactcctga tggcctacgc ctggtaccgc       240
     tcacagcctc ttcccggctt ttcggggcaa acaccaatgc agttggtcat gcatggccga       300
     gccaatgaag tgctcgaata tcttgatgcc gtggacgccg gtattcacgc ttga             354
//

If you have problems or comments...

PBIL Back to PBIL home page