(data stored in ACNUC7421 zone)

EMBL: CP000690.PE75

CP000690.PE75        Location/Qualifiers
FT   CDS_pept        83663..84184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3368"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3368"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28979"
FT                   /db_xref="InterPro:IPR014914"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTP7"
FT                   /protein_id="ABQ28979.1"
FT                   /translation="MTAASYKGLLYRAINPIYAADPMSGEGARLYGGRFNPRGVPAIYC
FT                   SISVMTALREANQAGALQPTTLVSYDAEIERVFDARDVSAVEAEGFSPGTLASQTWRDE
FT                   MKAGKQSQTQVFASRLIAKNYCALLVPSYVAGATPSDLNLVLWKWGSSTPSRLVLIDDQ
FT                   GRLAVPPLPA"
     ttgacggccg cttcctacaa agggcttctc taccgggcaa tcaatccgat ttatgcagcc        60
     gaccccatgt ctggtgaagg agcgcgtctt tacggcggta gattcaatcc gcgtggcgtt       120
     cctgcgattt actgttccat ttcagttatg acggctttgc gcgaagccaa ccaggccggt       180
     gcattacagc cgaccacact cgtttcatac gacgccgaga tcgagcgtgt cttcgacgct       240
     cgtgatgtat ctgccgtcga agccgagggg ttctcgccgg ggactcttgc ctctcaaaca       300
     tggcgcgatg agatgaaggc cggcaagcag tcgcaaacgc aggtctttgc gagccgtctg       360
     attgccaaga actattgcgc gctgctggtt ccaagctacg tggcgggggc tacaccgagt       420
     gaccttaacc tcgtgctttg gaagtggggc tcatcaacac cgtctcggct tgtgttgatt       480
     gacgaccagg gacggctcgc cgtgccccct cttcccgcct ga                          522
//

If you have problems or comments...

PBIL Back to PBIL home page