(data stored in ACNUC7421 zone)

EMBL: CP000690.PE76

CP000690.PE76        Location/Qualifiers
FT   CDS_pept        complement(84188..86872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3369"
FT                   /product="sigma-70 region 4 domain protein"
FT                   /note="PFAM: sigma-70 region 4 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3369"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28980"
FT                   /db_xref="GOA:A5FTP8"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTP8"
FT                   /protein_id="ABQ28980.1"
FT                   /translation="MHSIYILFLSQLQRVSRLKHMNASGTTLRDALDEIELARPTAQAV
FT                   SENPDSPLMTMSVANVLDLRNALLSREVSFRGFSVPILKQIFSHLDEAGYSHAGAARAQ
FT                   MNARQQDDARVAALAAVFRVLALVPFPEALLEADPAIRLRRILEDFVAARDSKDDWRAG
FT                   VHTLADLLSDWKGIMTRLQQADNFGAKSTTDLKLLVDGALLRATEAVASVVSKKDVATE
FT                   RLNLAGILAGDIPVPLQHMIGRADLDKVRDALPAFLAEPAHHLLGGSHGRKNRATELPG
FT                   FPGVIMRNEKQAQILAMRYGFFDKPATLDVVSNTVGITKERVRQIEVEAVKHLGREPSR
FT                   QKVEPIIEAHLPQLIEILTDGTGYLPDEASGEINRKAMIAHGVPGTVVLGLEALFPSAS
FT                   DLANRYGTRQGNGWLLGLDDKARGRAQATSKLLSTRLRGRRNAILVSDAMEAAGATTSE
FT                   ISAAVAMVPGAAIVGRHIIRDIDQLNERRAYQLYDLAIKLDDGAPFDLTRLCEAYAAAT
FT                   PEENNMPNCVPRAIAGAKGMFLNVIDRIWFPLQEKLPERPAGHAPLPYTIRPDMSQTSI
FT                   WRRPFGENTVAHFLHGQITRHGPIRTLDLAELTLPENYGSRSETLSGAQPIMKMNPNFV
FT                   HLSPGIYGLVEQLPKLTDPRRALPEVLLADRIVRAYTDARRVSPAAARIYPIWDMAFEY
FT                   RLARWAAEHANKKVAGALFDVVDPRMWPIAEDEITRWQAVKAEMSDRKQHHQTEQPDEY
FT                   ALPPADRFLASMITLWWMGEISWTLIGRTTNQRDMHTPASHLALLARFGLARAPKHWQD
FT                   RHLPTADLRPTLEAVIRDAVHADGISWRNPEMRALLSRDAGPGGWVDNDAVSRALQRPG
FT                   DPQLSVYGRTKVRRGRVLQPVNG"
     atgcattcta tatatattct atttttatcc caactccaga gggtcagcag gctgaaacac        60
     atgaacgctt ccggcacgac gcttcgagac gccctggacg agatcgagct ggcccgaccg       120
     accgcccagg cggtttcgga gaatcccgac agtccgctga tgaccatgag cgtcgcgaac       180
     gtactcgacc tcagaaacgc gctgctgagc cgggaggtct ccttcagagg cttctccgtg       240
     ccgatcctca agcagatctt cagccacctc gacgaggcgg gttactcgca tgccggtgcg       300
     gcccgggccc agatgaatgc gcgccagcaa gacgacgcgc gcgtcgcggc tctcgcggcg       360
     gttttccgcg tgcttgccct tgttcccttc cccgaagcgc tgctggaggc ggaccccgct       420
     atccggctgc gccggatcct cgaggatttc gtcgcggcac gggacagcaa ggatgactgg       480
     cgggctggcg tccacacgct ggccgacctg ctctcggact ggaaagggat catgacccgc       540
     ctccagcaag ccgacaattt cggggccaaa agcacgacag acctcaagtt gctggtcgac       600
     ggcgcgctcc tgcgcgcgac cgaggccgtg gccagcgttg tcagcaagaa ggatgtcgcc       660
     accgaacggc tgaaccttgc cggcatcctg gccggcgaca ttccggttcc gctgcagcac       720
     atgatcgggc gcgccgacct cgacaaggtc cgcgacgcgc tcccagcctt cctcgctgaa       780
     cccgcgcatc accttctcgg tggcagccac gggcggaaga accgcgcaac cgagcttccc       840
     ggcttccccg gcgtcatcat gcgcaatgag aagcaggcgc agatcctggc catgcgctac       900
     ggcttcttcg acaagccggc gacgctcgat gtcgtgtcca ataccgtcgg gatcaccaag       960
     gagcgcgtgc gccagatcga ggtggaggcg gtcaagcatc tcggccgcga gccttcgcgg      1020
     cagaaggtcg agccgatcat cgaggcgcat ctgcctcaac tgatcgagat cctgaccgac      1080
     ggaaccggct acctgcccga tgaggcatcc ggcgagatca accgcaaggc gatgatcgcc      1140
     cacggcgtgc cgggaaccgt ggtactgggc ctcgaggccc tgttcccgag cgcgtcggac      1200
     ctggccaacc gttacggcac caggcaaggc aatggctggc tgcttggcct cgacgacaag      1260
     gcacgcgggc gggcccaggc gaccagcaag ctgctgtcga ccaggctgcg cggccggcgc      1320
     aacgccatcc tggtgtccga cgccatggag gcggccggcg caacgacgag cgagatcagt      1380
     gctgccgtcg ccatggttcc cggcgccgcg atcgtcggcc gccacatcat ccgggacatc      1440
     gaccagctca acgagcgccg cgcctatcag ctctatgacc tcgcgatcaa gctggacgac      1500
     ggcgcgccgt tcgacctgac gcgcctgtgc gaggcttatg cggcggccac gccggaagag      1560
     aacaacatgc ccaactgcgt cccgcgcgcc attgccgggg cgaagggcat gttcctcaat      1620
     gtgatcgacc ggatctggtt cccgctacag gagaagctgc ctgaacgccc ggccgggcac      1680
     gcccccctgc cctacacgat ccggccggac atgtcgcaga cctccatctg gcggcggccg      1740
     ttcggcgaga acacggttgc ccatttcctg catggccaga tcacccgcca cggccccatc      1800
     cgcacgctgg atctcgcgga actcaccctg cccgagaact acggctcgcg cagcgagacg      1860
     ctcagcggtg cccagccgat catgaagatg aacccgaact tcgtgcacct gtcgccgggg      1920
     atctacgggc tcgtcgagca actgccgaag ctgaccgacc cgcggcgggc acttccggag      1980
     gtgctcctcg ccgaccggat cgtccgggca tacaccgatg ccaggcgcgt atcgccggcc      2040
     gcggcgcgga tctacccgat ctgggacatg gcgttcgaat accggctggc ccgctgggcg      2100
     gccgaacacg ccaacaagaa ggtcgcggga gcccttttcg acgtggtcga tccgcggatg      2160
     tggccgatcg cggaggacga aatcacgcgg tggcaggcgg tcaaggccga gatgtccgat      2220
     cgcaagcagc atcaccagac cgagcagccg gacgaatatg ccctgccgcc ggcggaccgg      2280
     ttcctcgcct ccatgatcac cctatggtgg atgggggaga tatcctggac gctgatcgga      2340
     cggaccacca accagcgcga tatgcacacg ccggcctctc acctggcgct cctcgcgcgc      2400
     ttcggcctgg cccgcgcacc gaagcactgg caggaccgcc atctgccgac cgccgacctg      2460
     cggccgacgc tggaggcagt gatccgcgat gcggtgcacg ctgatggcat cagctggcgt      2520
     aatccggaga tgcgagccct gctttcgcgt gatgcggggc ccgggggctg ggtcgacaac      2580
     gatgccgtga gccgtgcgct tcagcggcca ggtgacccgc agctctcggt ttacggccgg      2640
     accaaggtgc gacggggacg cgtgctgcag ccggttaacg gctga                      2685
//

If you have problems or comments...

PBIL Back to PBIL home page