(data stored in ACNUC7421 zone)

EMBL: CP000690.PE77

CP000690.PE77        Location/Qualifiers
FT   CDS_pept        complement(87261..87539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3370"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28981"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTP9"
FT                   /protein_id="ABQ28981.1"
FT                   /translation="MNTKIWATKQRVKSMSSMPMPARLVWTDGHDRAPGGFRHADRVHG
FT                   RDARGAVVKAVTDSSVVGPSRASPKAIRPGFRRIASAMEAAQYCCLA"
     ttgaacacca agatctgggc gacaaagcag cgcgtcaaat cgatgagttc aatgccaatg        60
     cccgcgcgac tggtctggac tgatggccat gatcgtgcgc cgggcggttt tcgacacgcc       120
     gatcgggtgc atggtcgaga tgcaaggggg gcggtggtga aagcggtgac cgattcttcg       180
     gtcgtcggac cgtcgcgggc ttcgccgaaa gcgatcaggc cgggctttcg acgcatcgcg       240
     tcggcgatgg aggctgccca atactgttgt cttgcctga                              279
//

If you have problems or comments...

PBIL Back to PBIL home page