(data stored in ACNUC7421 zone)

EMBL: CP000690.PE78

CP000690.PE78        Location/Qualifiers
FT   CDS_pept        87871..88137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3371"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="PFAM: helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3371"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28982"
FT                   /db_xref="GOA:A5FTQ0"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTQ0"
FT                   /protein_id="ABQ28982.1"
FT                   /translation="MIKDAQAFGALVQARRKSLGLTQRQLALAINSGERFIVDLEAGKT
FT                   TCQLGKALAAANAVGIELADTGARGASTERRGEQELDLPEVDL"
     atgatcaaag acgcccaagc ttttggtgcg ctggtccagg cacgcaggaa atcactgggg        60
     ctgacacagc gccagttggc gctggcgatc aattccggcg agcggttcat cgtggatctc       120
     gaggccggga agacaacctg ccagctgggc aaggcactcg ccgctgccaa cgccgtgggg       180
     atcgagcttg ccgacactgg ggcgcggggc gcgtcaacag agcggcgggg tgagcaagag       240
     ctcgaccttc ctgaggtcga cttatga                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page