(data stored in ACNUC7421 zone)

EMBL: CP000690.PE79

CP000690.PE79        Location/Qualifiers
FT   CDS_pept        88134..89282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3372"
FT                   /product="HipA domain protein"
FT                   /note="PFAM: HipA domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3372"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28983"
FT                   /db_xref="InterPro:IPR012893"
FT                   /db_xref="InterPro:IPR017508"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTQ1"
FT                   /protein_id="ABQ28983.1"
FT                   /translation="MSDHTPVFYETLLVGMIHTDTRGSCFTYDESWLSRTGSFQISLTM
FT                   PLGRPAVEHHVIMPWLANLLPEGDAISTIARRSGIATGDILSLLMVVGRDTAGALSIGQ
FT                   PRSREGRHYMTIAGQDALERLIEDLPRRPLLSGDDGVSMSLPGAQEKLPVVLNDNDIAL
FT                   PLNGAPSTHIIKPNNRRLPGSVQNEALCMVLARRVGLDVADVTTGQAGKRSYLLVERYD
FT                   RIQRGGVWRRLHQEDFCQALSLPPASKYQHNRTGILGPGLADLFRTVRTFMTARDTIRL
FT                   LDAVIFNVLITNVDSHAKNYSIMLTGRARLSPLYDLMAGDAWSEVTQNLPQDIGGKNRG
FT                   QYINHLHWRRMAEESGLSAGAVVRRVIQMATALPSMLDQAVD"
     atgagcgacc acacgccggt tttctatgag accctgctgg ttggtatgat ccatacggac        60
     accaggggct cttgcttcac ctatgacgag agctggctgt cacggacagg cagcttccag       120
     atctcactca ccatgccgct tggccgccca gcggtggagc accatgtcat catgccatgg       180
     ctggcaaacc tgctgccaga aggcgatgcc atcagtacga tcgcgaggcg gtccggaata       240
     gccaccggcg atattctcag cctcctcatg gtcgtcggca gggacaccgc gggcgcgttg       300
     agcattggtc agcctcgcag ccgcgagggg cgccattata tgacgatcgc cggtcaggac       360
     gcgctggagc ggctcatcga agatttaccg cgccggccgt tgctgtcggg agatgacggc       420
     gtctcgatga gcctgcccgg cgcgcaggag aaattgcccg tcgttctcaa tgacaacgat       480
     attgcgcttc cgctaaacgg ggcgccgtca acccacatca tcaagcccaa caaccgaaga       540
     ctgccaggca gcgttcagaa cgaggcactc tgcatggttc tggcacgacg ggttgggctc       600
     gatgtggccg acgtcaccac cggccaggcc ggcaagcgct cctatcttct ggttgagcgc       660
     tatgaccgga tccagcgtgg cggcgtgtgg cgccggctac accaggaaga tttctgccag       720
     gcactgtcgc tacctccggc gtcgaagtac cagcacaaca gaacgggtat ccttgggcca       780
     ggactggccg acctcttccg gaccgtcagg actttcatga cggcgcgcga tacgatcagg       840
     cttctcgatg cggttatctt caacgtgctg atcacgaacg tcgattccca tgcgaagaac       900
     tattcgatca tgttgactgg gcgtgcccgg ctctcgccac tttacgatct gatggccggc       960
     gatgcgtggt ccgaggttac ccagaatctc cctcaggaca tcggcggcaa gaaccgcggc      1020
     caatacatca atcatttgca ctggcgtcgg atggcggagg aatcaggtct cagcgccggc      1080
     gccgttgtcc ggcgggtgat ccagatggca acggcccttc catccatgct cgatcaggcg      1140
     gttgattag                                                              1149
//

If you have problems or comments...

PBIL Back to PBIL home page