(data stored in ACNUC7421 zone)

EMBL: CP000690.PE8

CP000690.PE8         Location/Qualifiers
FT   CDS_pept        complement(12089..12448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3300"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28912"
FT                   /db_xref="InterPro:IPR021027"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTI0"
FT                   /protein_id="ABQ28912.1"
FT                   /translation="MALVMRRVTLKLYPSATQATEMERVCDLHRALYNAALQERIDAWR
FT                   LSKTSIGYAAQCKSVTQIRRDDTAYLGLNAQSLQVTLKRLDMAFSHFFRRVKAGETPGF
FT                   PRYKGRDRFPGWGYM"
     atggcacttg tcatgcgccg cgtcacgctg aagctgtatc cttccgccac gcaggcgacc        60
     gagatggagc gcgtctgcga ccttcatcgg gcgctgtaca acgccgccct gcaagaacgc       120
     attgacgcat ggcgcctgtc caagacctcc ataggctatg cggcgcagtg caagtccgtc       180
     acccagatca ggcgcgatga caccgcctat ctcgggctga atgcgcagtc cctgcaggtc       240
     acgctcaagc gcctcgatat ggctttcagc catttcttcc gccgagtgaa ggcaggcgag       300
     acgccggggt ttccgagata caagggccgc gaccgcttcc ctggctgggg gtacatgtag       360
//

If you have problems or comments...

PBIL Back to PBIL home page