(data stored in ACNUC7421 zone)

EMBL: CP000690.PE80

CP000690.PE80        Location/Qualifiers
FT   CDS_pept        89444..89701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3373"
FT                   /product="IstB domain protein ATP-binding protein"
FT                   /note="PFAM: IstB domain protein ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3373"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28984"
FT                   /db_xref="GOA:A5FTQ2"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTQ2"
FT                   /protein_id="ABQ28984.1"
FT                   /translation="MRLYFLVLDELGYLPFAQTGGQLLFHLISRLYERTSIIVTTNLAF
FT                   GEWPSVFGDAKMTTALLDRLTHHCEIIETGNDSWRFKNRA"
     atgaggctct acttcctcgt cctcgacgaa ctcggctatc tccccttcgc ccagaccggc        60
     ggccagctcc tcttccatct tatcagccgc ctctacgagc gcacctcgat catcgtcacc       120
     accaacctcg ccttcggcga gtggcccagc gtcttcggcg atgccaagat gaccaccgca       180
     ctcctcgatc gcctcacgca ccactgcgaa atcatcgaaa ccggcaacga cagctggcgc       240
     ttcaaaaacc gcgcctga                                                     258
//

If you have problems or comments...

PBIL Back to PBIL home page