(data stored in ACNUC7421 zone)

EMBL: CP000690.PE83

CP000690.PE83        Location/Qualifiers
FT   CDS_pept        93356..93748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3377"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3377"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28987"
FT                   /db_xref="GOA:A5FTQ5"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTQ5"
FT                   /protein_id="ABQ28987.1"
FT                   /translation="MNAGATLPNATLKVLEEEGEPEFSTRDVCAIAKVTAPTLYHHIGS
FT                   ADIPTAEEAFTLLTACVAAIAGEGSLTQKVDAAPDIMWTSTKAASLLCGTASLRKLSTP
FT                   TAAVLEQKRQGAFRSILKSKSNVQSQ"
     atgaatgccg gcgccactct gccaaatgca accttgaagg tcctggagga ggaaggcgag        60
     ccagagttct cgacgcgcga tgtctgcgcg atcgcgaagg tgacagcacc gacactctac       120
     catcacattg gcagcgccga cattcctacc gctgaagagg ctttcacgct cctgactgcg       180
     tgtgttgcag caattgccgg tgaagggagc ctcacgcaaa aagtcgatgc ggctcccgat       240
     atcatgtgga cgtcgacgaa agcggcatcg cttctttgtg gcaccgcgtc gctccgcaag       300
     ctgtcgacgc ccaccgctgc cgtcctcgag caaaagcgcc agggcgcctt tcggtccatc       360
     ctgaaatcca aatcgaatgt acaatcacaa tga                                    393
//

If you have problems or comments...

PBIL Back to PBIL home page