(data stored in ACNUC7421 zone)

EMBL: CP000690.PE84

CP000690.PE84        Location/Qualifiers
FT   CDS_pept        complement(94167..94619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3378"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3378"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28988"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTQ6"
FT                   /protein_id="ABQ28988.1"
FT                   /translation="MTRVRRFRRTFGNNRRENATAPEGSACKKTFEIAADDKAVERGDR
FT                   HQIHAARLIMAAHGRGHDKIALPLVRRDPYQDRGSEIEVPVVFPQHKLPLRTRQDRKER
FT                   HGRETFGLGILPYPPRGLYSTQRNDSVAEAEQRLKPGWWVFQRLAR"
     gtgacgcggg tgcgtcggtt ccgacgcaca ttcggaaata atcgccgaga aaatgcaacc        60
     gcccctgaag ggtcagcgtg caagaaaacg ttcgagattg ctgcggacga caaggcggtg       120
     gaacggggcg atcgtcatca gatacacgcg gcccggctga ttatggcagc gcacggccgt       180
     ggtcatgata agatcgcgct tcccctcgtc cgtcgtgacc cgtatcagga ccgaggctct       240
     gaaatcgagg tgccggtcgt cttcccccag cacaagctcc cgctccgaac gcgacaggac       300
     cggaaagaac gccacggtcg cgagaccttc ggactcggca tcctgccgta tccgccgaga       360
     ggactttact ccacccaacg aaacgatagc gtcgcggagg cggagcaacg cctgaaacca       420
     ggctggtggg tgttccagcg cctcgcgcgc taa                                    453
//

If you have problems or comments...

PBIL Back to PBIL home page