(data stored in ACNUC7421 zone)

EMBL: CP000690.PE85

CP000690.PE85        Location/Qualifiers
FT   CDS_pept        94823..96502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3379"
FT                   /product="transposase, IS4 family"
FT                   /note="PFAM: transposase, IS4 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3379"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28989"
FT                   /db_xref="GOA:A5FTQ7"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTQ7"
FT                   /protein_id="ABQ28989.1"
FT                   /translation="MFFRIKPSGGRRYLQIVENKRVDGKVRQVVRLTIGRMDELEASGQ
FT                   LARLLTSGARHCEQMMLLSAIENEATTLSMRRFGAPLLFGRLWQESGIAAVFEELLAGR
FT                   QFEFPVERAVFATVLHRIMVSGSDRACDKWLEDYDIPGTEELGLHHLYRAMAWLGEELP
FT                   DEEQGDATPFAPRTVKDLVEERLFARQHDLFTDLSVVFMDTTSLYFEGADGETLGARGH
FT                   SKDYRPQLAQMILGVVIDQDGRPICTEMWPGNTADVSVLVPVIDRLRSRFGITRVCVVA
FT                   DRGMISAATIAALEERGLEYVLGARERTDRIVREVVLADERPYIPLCLERAGGDETQLF
FT                   IKEVKVAGKHYIVCRNEAVAIEEAETRRQVVAALDRQLTRGDKALIGNSAYRRFLRPVS
FT                   DAKPGRKSKLFEIDAGKLAEEARFDGVFVLRSNARISPLQAVLRYRDLQNVEQLFRVAK
FT                   ATMRTRPIYHSSAAAIRGHVFCSFLALILHQALDEKLRRAGKRVEWADLLRDLDRLQHG
FT                   EISQNGKRWQLRTEAGVAAATAFKAARIALPPRLQTPQQAVT"
     atgttcttcc gcatcaaacc atcaggtggc cgtcgctacc tgcagatcgt cgagaacaag        60
     cgggtcgatg gcaaggtccg ccaggttgtg cggctgacca tcggccggat ggacgaactc       120
     gaagcaagcg gccagctcgc gaggctcctc acctccggcg cccgccattg cgagcagatg       180
     atgctgctct ccgccatcga gaatgaggcg accacgctga gcatgcgccg gttcggcgcg       240
     ccattgctgt tcggccgact gtggcaggag agcgggatcg ctgcggtgtt cgaggagctg       300
     ctggccgggc ggcagttcga gttcccggtc gagcgcgcgg tgttcgccac cgtgctccac       360
     cggatcatgg tctcgggctc ggatcgcgcc tgcgacaaat ggctcgagga ttacgacatt       420
     cccggcaccg aggagctcgg cctgcatcac ctctaccgcg ccatggcctg gctcggcgaa       480
     gagctgccgg acgaggaaca gggggatgcc acgccctttg caccgcggac ggtgaaggat       540
     ctggtggaag agcggctctt cgcccgacag catgatctgt tcaccgacct ctcggtcgtg       600
     ttcatggaca ccacctcgct gtatttcgaa ggtgccgacg gcgagacgct gggcgcgcgg       660
     ggccactcca aggattaccg cccacagctc gcgcagatga tcctgggcgt ggtgatcgat       720
     caggacggcc ggccgatctg caccgagatg tggccgggca acaccgccga tgtctcggta       780
     ctggtgccgg tgatcgaccg cctgcggtcg cgcttcggca tcacccgggt ctgcgttgtc       840
     gccgatcgcg gcatgatcag cgccgcgacg atcgccgcgc tggaggagcg cggactggaa       900
     tacgtcctcg gcgcaaggga acgcaccgac cgcatcgtcc gcgaggtggt gctggccgat       960
     gagcgcccct acatcccgct ctgcctcgag cgcgccggtg gcgacgagac ccagctcttc      1020
     atcaaggagg tcaaagtcgc gggcaagcat tacatcgtct gccgcaacga ggcggtggcc      1080
     atcgaagagg ccgagaccag gcgccaggtg gtcgccgccc tcgatcgtca gctgacgcga      1140
     ggcgacaagg cgctgatcgg caactccgcc tatcgccgct tcctgcgccc agtcagcgac      1200
     gcaaagcccg gccgcaagag caagctgttc gagatcgacg ccggcaagct cgccgaggaa      1260
     gcccgcttcg acggcgtctt cgtgctgcgc tccaatgcca ggatctcgcc gctgcaggcg      1320
     gtgctccgct accgggacct gcagaatgtc gaacagctgt tccgtgtggc gaaggcgacg      1380
     atgcgcaccc ggccaatcta ccattcctcc gccgccgcca tccgcggcca tgtgttctgt      1440
     tcttttctcg cgctgatcct gcaccaggcg ctcgacgaaa aactccgccg ggccggcaag      1500
     cgcgtcgaat gggccgatct ccttcgtgat ctcgacagac tgcagcacgg cgaaatcagt      1560
     cagaacggca agcgctggca gctgcgcacc gaagccggcg ttgcggcggc cacagccttc      1620
     aaagccgccc gcatcgccct gccgccccgt ctgcagaccc cccagcaagc cgtaacctga      1680
//

If you have problems or comments...

PBIL Back to PBIL home page