(data stored in ACNUC7421 zone)

EMBL: CP000690.PE86

CP000690.PE86        Location/Qualifiers
FT   CDS_pept        97123..97491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3380"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28990"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTQ8"
FT                   /protein_id="ABQ28990.1"
FT                   /translation="MHSATGHLILITTLTFRPSEIGEAIQSSPEIGRRIEAASRRDADT
FT                   PPTAQDSDCTKQVGQNLDSVVAALIHRGPDAHEVNDVGKQRKLNGGRAGYRWHARAAFD
FT                   HRWHGRCRWCPLRPDLLA"
     atgcatagcg cgacgggcca cctgatcctg ataaccacgc tcacgtttcg cccgagcgag        60
     atcggcgagg cgatccagag cagtcccgag atcgggcgca ggatcgaagc ggcttctcga       120
     cgagatgccg atacgccccc aacagcgcag gattccgatt gtaccaaaca ggtcggtcaa       180
     aacctcgatt ctgtagtagc ggcgctcatt catcgcgggc cggatgcgca cgaggtcaac       240
     gacgtcggga aacaaaggaa gctgaacggc ggtagggctg ggtacagatg gcatgcgcgg       300
     gcggcgtttg accaccggtg gcacggccgg tgcagatggt gtccgctgcg tccggatctc       360
     ctggcgtga                                                               369
//

If you have problems or comments...

PBIL Back to PBIL home page