(data stored in ACNUC7421 zone)

EMBL: CP000690.PE87

CP000690.PE87        Location/Qualifiers
FT   CDS_pept        97955..98353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3381"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3381"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28991"
FT                   /db_xref="InterPro:IPR017895"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTQ9"
FT                   /protein_id="ABQ28991.1"
FT                   /translation="MKRLTMRNIREAQRLHAGGLSTRKIAASLGVGQSTASDYLKPVEH
FT                   AGLSWPLAAEMTDAALEALLFHPIGGPSRLVEAQPDWPAIHPRDCGAPALHTALLCGFG
FT                   TCPPLVQLLVKTRVPKPGGLTGGASDIA"
     atgaagagac ttacgatgcg gaacatcaga gaagcgcagc ggctgcatgc cggcggattg        60
     tcgacacgga agatcgccgc gagcctcggc gtcgggcaga gcacggcgag cgattatctc       120
     aagccggtcg agcatgccgg gctgagctgg ccgctcgcgg ctgagatgac ggacgcggcg       180
     ctggaggcgt tgctgtttca tccgatcggc ggccccagcc gtctcgtcga ggcgcagccg       240
     gactggccgg cgatccatcc tcgagattgc ggcgcaccgg cgctccatac ggctttgttg       300
     tgcggctttg gcacgtgccc gccgctcgtc cagctcctgg tcaagaccag agtaccgaag       360
     cccggcggcc tgacgggtgg cgcgagtgat atcgcctga                              399
//

If you have problems or comments...

PBIL Back to PBIL home page