(data stored in ACNUC7421 zone)

EMBL: CP000690.PE88

CP000690.PE88        Location/Qualifiers
FT   CDS_pept        complement(99228..100943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3383"
FT                   /product="pyruvate dehydrogenase (cytochrome)"
FT                   /note="PFAM: thiamine pyrophosphate enzyme domain protein
FT                   TPP-binding; thiamine pyrophosphate enzyme, central region;
FT                   thiamine pyrophosphate enzyme TPP binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3383"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28992"
FT                   /db_xref="GOA:A5FTR0"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTR0"
FT                   /protein_id="ABQ28992.1"
FT                   /translation="MASTVAEIIVDTLCQAGARRCWGIVGDTINHFTDAVRKSDLRWVH
FT                   VRHEEAGALAAGGEGYLTGELAVCAGTCGPGSLHFVNGIFESHRNGAPVVLIASDVARA
FT                   EAGLRFPQEVDQRKIYEQASVFCEYVSHPDQARRITTLAAQAALTRGGVAVVIVNGDMF
FT                   TETTDDRLEWRVHRPSSVLRPSDDELDALARDLDSAARVTIYAGIGARGAAARVVQLAG
FT                   LLKAPIVHTSRAKEFIEPNNPFNIGMTGILGNRAGVEAIDAADIMLCLGTDFAWTQFYP
FT                   DARYVIQIDSDPTHLGRRAPIRTGLVGDVGATIEALLPRLKTRSDSAHLDRSLKRWAAD
FT                   REGYAKLACAHDDALIHPQTVAQTLDTLAADDAIFTADGGSPMVWLLRHVTANGRRSFL
FT                   TSLLHGTMANAYPQAMGMAAAFPGRQVIAMCGDGGMTMLMGDLLTLVQEKLPIKLLVFN
FT                   NGSLGFVEMEQRVEGLIDSFTELKNPDFAKLAEVCGISGWRVDTGPELEPAMRRWLAAE
FT                   GPALLDVHVNRVELVMPPKVEIGQVASTALFGVRAVLDGRSREVVQLLRDNFLR"
     atggccagca ccgtagcgga aatcatcgtc gatacgcttt gccaagccgg cgcccgccgc        60
     tgctggggca tcgtcggcga cacgatcaat catttcaccg atgccgtccg gaaatcggac       120
     ctccgctggg tccatgtccg ccacgaggaa gccggcgccc tcgccgccgg cggcgagggc       180
     tacttgaccg gcgagctcgc cgtctgcgct ggcacgtgcg ggcccggcag cctgcatttc       240
     gtcaacggca tcttcgaatc ccaccgcaac ggcgcaccgg tcgtgctgat cgcctccgac       300
     gtggcccgtg ccgaggcggg gctgcgcttt ccccaggaag ttgaccagcg gaagatctac       360
     gaacaggcca gcgtcttctg cgaatatgtg agtcacccgg accaggcgcg gcggatcacg       420
     acgctcgcgg cccaggcggc gctcacgcgg ggcggggttg ccgtggtgat cgtgaacggc       480
     gacatgttca ctgaaacgac ggatgacagg cttgaatggc gagtccaccg gccatcctcc       540
     gtgctgcgcc cgtcagacga cgagctcgac gccctcgccc gcgatctcga cagcgcggcc       600
     cgcgtcacga tctatgccgg catcggcgcg cgcggcgcgg cggcccgagt cgtgcagctt       660
     gccggcctac tgaaggcgcc gatcgtccat accagccgcg ccaaggaatt tatcgagccg       720
     aacaatccgt tcaacatcgg catgaccggc attctcggca atcgcgccgg cgtcgaagcg       780
     atcgatgcgg ccgatatcat gctctgcctc ggcaccgatt tcgcgtggac gcagttctat       840
     cccgacgccc gttacgtgat ccagatcgac agcgacccga cgcacctcgg acggcgcgcg       900
     ccgatccgga cagggctggt cggcgatgtc ggcgcgacga tcgaggccct gctgccccgg       960
     ctaaagacga ggagcgacag cgctcatctc gacaggtcgc ttaagcgctg ggccgcggat      1020
     cgcgagggtt acgcaaaatt ggcctgcgcg cacgacgacg cgctgatcca tccgcagacc      1080
     gtcgctcaga cgctcgacac gctggccgcg gacgacgcga tcttcaccgc tgacggcggt      1140
     tccccgatgg tatggctgct ccgccatgtc accgcaaacg gccgccgtag cttcctgacc      1200
     agcctcctgc atggcaccat ggcgaacgcc tacccgcagg cgatgggcat ggcggccgcc      1260
     tttccaggcc gccaggtcat cgccatgtgc ggcgacggcg gcatgaccat gctgatgggc      1320
     gacctgctga cgctggtgca ggaaaagttg ccaatcaaac tgctggtctt caacaatggc      1380
     tcgctgggtt tcgtcgagat ggagcagagg gtagaaggtc taatcgattc cttcacggag      1440
     ttgaagaacc cggattttgc gaaactcgcg gaggtttgcg gcatcagcgg ctggcgcgtg      1500
     gacaccggcc ccgagctcga gccagcgatg cggcgctggc tggccgccga gggccctgcc      1560
     ttgcttgatg tccatgtgaa ccgggtcgaa ctggtcatgc caccgaaagt agagatcggc      1620
     caggtcgcct cgactgccct gttcggcgta agagcggtgc tcgacggacg ttcgcgggaa      1680
     gttgttcagc tactgcgcga caattttctc cgctga                                1716
//

If you have problems or comments...

PBIL Back to PBIL home page