(data stored in ACNUC7421 zone)

EMBL: CP000690.PE9

CP000690.PE9         Location/Qualifiers
FT   CDS_pept        12472..12888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3301"
FT                   /product="transposase IS200-family protein"
FT                   /note="PFAM: transposase IS200-family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3301"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28913"
FT                   /db_xref="GOA:A5FTI1"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTI1"
FT                   /protein_id="ABQ28913.1"
FT                   /translation="MAEQAKFSKLYHCVYALNYHLVLVTKYRRKCITGPMLGRFREIAA
FT                   ARCEGWGGKLIEVNGEPDHVHLLISLPPNLDLSRFVNNLKTTTSRLIRKEFAAEVDTVY
FT                   RKPVFWSRSYCVISCGGAPLSVIKQYIEQQAAPE"
     atggcagaac aagctaaatt ttctaaatta tatcattgtg tttacgcgct aaactatcac        60
     ttggttcttg tgacaaagta ccggcgcaaa tgcatcacag gcccgatgct cggccgcttc       120
     cgtgagatcg ccgcggcccg gtgcgagggg tggggcggca aactgatcga ggtgaacggt       180
     gaaccggatc acgtccacct gctgatctcc ctaccgccga acctcgacct cagccggttc       240
     gtgaataacc tcaagacaac aacctcccgg ctgatccgca aggagttcgc cgccgaggtg       300
     gacacggtct accgaaagcc ggtgttttgg agccggtcat actgcgtgat ttcgtgcggg       360
     ggcgctcccc tgtccgtcat caagcaatac atcgagcagc aggcggcacc ggaatga          417
//

If you have problems or comments...

PBIL Back to PBIL home page