(data stored in ACNUC7421 zone)

EMBL: CP000690.PE90

CP000690.PE90        Location/Qualifiers
FT   CDS_pept        103176..104042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3385"
FT                   /product="MltA-interacting MipA family protein"
FT                   /note="PFAM: MltA-interacting MipA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3385"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28994"
FT                   /db_xref="InterPro:IPR010583"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTR2"
FT                   /protein_id="ABQ28994.1"
FT                   /translation="MNRFSELLGSRKPIWLLAPFAVTCSATPARAQTPSPLAEWQYSSG
FT                   IQLQRLFEPKIPTWQVELGLGTQFAPAAPGLNRYRIQGGPGIDIRYKNRFFLSTGEGLG
FT                   VNLFSFRHISFGTAISYDLGRSPHVDGEALNGLGTIHPAPELKVFATTVLTEGFPLTIR
FT                   VDIRKQFGASFGYIGDVGAYMPMPGSSKTFSWFLGPTVTLADARYMNTYFGVSHAQAAS
FT                   SKYHYYHAHGGFRSAGIGISANYFVTPHVIINLNAAYERLLGSAAKSPITQTVNEGVVS
FT                   LSALYKF"
     atgaacaggt tttcagaatt actcggttcc cggaaaccta tctggctcct tgctcccttt        60
     gccgtcacat gcagtgccac ccccgcgagg gcgcagacgc cttcgccact cgccgaatgg       120
     caatactcct cgggcatcca actccagcgc ctgttcgagc cgaaaatccc gacctggcag       180
     gtcgagctcg ggctgggcac acagttcgcc cccgccgcgc ccggccttaa tcgctaccgg       240
     atccagggcg gccccggcat cgatatccgc tacaagaatc gcttcttcct ctccaccggg       300
     gaggggctgg gcgtgaacct attcagcttc cgccatatca gcttcggcac cgcgatttcc       360
     tacgatctcg gccgctcccc ccatgtcgac ggcgaggcgc tgaacggtct cgggaccatc       420
     catccggcgc cagagctcaa ggttttcgcg actacggtac tcacggaggg ctttccgctg       480
     accatccgcg tcgacatccg taagcaattc ggcgcatcct ttggctatat cggtgatgtc       540
     ggcgcctaca tgccgatgcc cggcagctcg aaaacatttt catggttcct cggccccacc       600
     gtcaccctgg ccgacgcgcg ctacatgaac acctatttcg gcgtcagcca cgcccaagca       660
     gcaagctcga aataccatta ttaccacgcc catggcggct tccgctcggc gggcattggg       720
     atatcggcaa attatttcgt caccccgcat gtcatcatca acctcaacgc agcctatgag       780
     cggctgctcg gcagcgcggc gaagagcccg atcacgcaga ccgtaaacga aggcgtcgtc       840
     tccctttcgg cgctgtacaa gttctga                                           867
//

If you have problems or comments...

PBIL Back to PBIL home page